Portfolio 
Experience Catalogue Portfolio
The catalogue of contemporary photography in Britain. Contains details of the back issues of the publication, subscription information, an artists index, and a search facility to locate the name of writers or topics of interest.Portfolio Catalogue The catalogue of contemporary photography in Britain Secure on line ordering of subscriptions and back issues
Feel free to add your comment or post!
Business Hours
Opening hours for Portfolio ($) *Reviews
Portfolio
Portfolio Review ›
portfoliocatalogue.com
Statistic generated on
2024-04-19
SiteBook.org Points
(According to Visits for this Profile)
(According to Visits for this Profile)
Address
| Website | portfoliocatalogue.com |
| Name | Portfolio |
| Street | |
| ZIP Code | |
| City | |
| Region | |
| State | |
| Phone No. |
Catalogue Portfolio Photography Neeta Britain Contemporary Madahar Photographic Edinburgh Artistssuky Anna Magazine Cherry Photography Magazines And E-zines Portfolio Catalogue Contemporary Photography Britain Uk Edinburgh Fine Art Gallery Magazine Artists Photographic
Reviews and Comments for Portfolio
Feel free to add your comment or review!
Best entries for Catalogue and Portfolio
1 Portfolio
The catalogue
The catalogue of contemporary photography in Britain. Contains details of the back issues of the publication, subscription information, an artists index, and a search facility to locate the name of writers or topics of interest.
Catalogue Portfolio Photography Neeta Britain Contemporary Madahar Photographic Edinburgh Artistssuky Anna Magazine Cherry
The catalogue of contemporary photography in Britain. Contains details of the back issues of the publication, subscription information, an artists index, and a search facility to locate the name of writers or topics of interest.
Catalogue Portfolio Photography Neeta Britain Contemporary Madahar Photographic Edinburgh Artistssuky Anna Magazine Cherry
2 nielsen: the fog catalogue
andrew jackson
andrew jackson presents a rendering of the fs catalogue, first compiled in 1965 by dan fog and torben schousboe. recognized as the authoritative listing of works by the composer.
Sign Now Lifestream Policy Everything People Account Places Date Nowon Aolcom Privacy Youre Networks Read Login
andrew jackson presents a rendering of the fs catalogue, first compiled in 1965 by dan fog and torben schousboe. recognized as the authoritative listing of works by the composer.
Sign Now Lifestream Policy Everything People Account Places Date Nowon Aolcom Privacy Youre Networks Read Login
3 Mary Cassatt - Catalogue Raisonne
Information concerning
Information concerning the current catalogue raisonne being written by Adelson Galleries.
Z Y
Information concerning the current catalogue raisonne being written by Adelson Galleries.
Z Y
4 Manstream, Kathleen
Portfolio of
Portfolio of graphic design work. Site includes a tour of the portfolio.
Designer Long Island Graphic Art Director Portfolio Manstream Kathleen Ny Graphics Web Artist Motion Kathleen@kathleenmanstreamcom Comps Video
Portfolio of graphic design work. Site includes a tour of the portfolio.
Designer Long Island Graphic Art Director Portfolio Manstream Kathleen Ny Graphics Web Artist Motion Kathleen@kathleenmanstreamcom Comps Video
5 Manstream, Kathleen
Portfolio of
Portfolio of graphic design work. Site includes a tour of the portfolio.
Designer Island Long Art Graphic Director Manstream Ny Portfolio Kathleen Graphics Web Artist Motion Photography Found The
Portfolio of graphic design work. Site includes a tour of the portfolio.
Designer Island Long Art Graphic Director Manstream Ny Portfolio Kathleen Graphics Web Artist Motion Photography Found The
6 susie yang portfolio
fashion design
fashion design illustration artist. includes resume, portfolio, and biography.
Permalink Union Yang Designer | Portfolio Art Studio Susie Pixel Artist Theme Design Request Note
fashion design illustration artist. includes resume, portfolio, and biography.
Permalink Union Yang Designer | Portfolio Art Studio Susie Pixel Artist Theme Design Request Note
7 Zarrow, Alison
Online portfolio
Online portfolio of Tulsa Oklahoma based photographer. Site includes portfolio, resume and contact information.
Oops Found File Qfoliocomz
Online portfolio of Tulsa Oklahoma based photographer. Site includes portfolio, resume and contact information.
Oops Found File Qfoliocomz
8 Buchanan, James
Online portfolio
Online portfolio of jewelry and fashion photography. Features galleries, information about the artist and the option to download a portfolio.
Photographer Photography James Email Melbourne Buchanan Skype Click Campaigns Australia Here Advertising Photo Newsletters Contacts
Online portfolio of jewelry and fashion photography. Features galleries, information about the artist and the option to download a portfolio.
Photographer Photography James Email Melbourne Buchanan Skype Click Campaigns Australia Here Advertising Photo Newsletters Contacts
9 iosca, philip
online portfolio
online portfolio of this textile designer working in jacquard-weave, machine knits and surface design. site includes portfolio, resume and contact information.
Request Cargo Nginx Renew Support Ioscaindustriesupgrade Z
online portfolio of this textile designer working in jacquard-weave, machine knits and surface design. site includes portfolio, resume and contact information.
Request Cargo Nginx Renew Support Ioscaindustriesupgrade Z
10 stephen tuttles portfolio of works
a portfolio
a portfolio of creative work by stephen tuttle including a gallery of carved wood vessels.
Tuttle Stepheny
a portfolio of creative work by stephen tuttle including a gallery of carved wood vessels.
Tuttle Stepheny
11 nrq literary portfolio
literary portfolio
literary portfolio that showcases poetry and prose of different topics. [flash and shockwave player required]
Create Tripod Signup Hosting Shopping Login Tripodcom Errorpage Check Lycos Requested Page Couldntfound Lycoscom
literary portfolio that showcases poetry and prose of different topics. [flash and shockwave player required]
Create Tripod Signup Hosting Shopping Login Tripodcom Errorpage Check Lycos Requested Page Couldntfound Lycoscom
12 Wrightson, Ann
Online portfolio
Online portfolio of Ann Wrightson, New York City based Theater Lighting Designer. Site includes portfolio, resume and contact information.
Online portfolio of Ann Wrightson, New York City based Theater Lighting Designer. Site includes portfolio, resume and contact information.
13 Portfolio Center
Offers two-year
Offers two-year, intensive full-time training for portfolio development in graphic design, advertising, photography and industrial design. Located in Atlanta, Georgia.
Hosting Domain Marketing Solutions Web Network Services Names Registration Website Netsol |innovative Host
Offers two-year, intensive full-time training for portfolio development in graphic design, advertising, photography and industrial design. Located in Atlanta, Georgia.
Hosting Domain Marketing Solutions Web Network Services Names Registration Website Netsol |innovative Host
14 turner, kerry
picture, biography
picture, biography, catalogue of works, and discography.
Horn Turner Httpopllu Quartet Music Orchestra Kerry Horns American Chamber Philharmonic Luxembourg Concert Symphony Bach Frank Churchdallas English
picture, biography, catalogue of works, and discography.
Horn Turner Httpopllu Quartet Music Orchestra Kerry Horns American Chamber Philharmonic Luxembourg Concert Symphony Bach Frank Churchdallas English
15 experimental music catalogue
events, articles
events, articles, history, and links.
Experimental Music Catalogue Studies Catalogue_ Journal Cagejohn Z
events, articles, history, and links.
Experimental Music Catalogue Studies Catalogue_ Journal Cagejohn Z
16 bjørnseth, thomas
(1957 -)norway.
(1957 -)norway. brief biography and catalogue.
(1957 -)norway. brief biography and catalogue.
17 jakubowski, pascale
picture and
picture and biography from the musik fabrik catalogue.
Navigationshilfe Ty
picture and biography from the musik fabrik catalogue.
Navigationshilfe Ty
18 John Singer Sargent - Catalogue Raisonne
Information concerning
Information concerning this project.
Z Y
Information concerning this project.
Z Y
19 soluri, patrick
includes catalogue
includes catalogue, performance schedule and reviews.
Soluri Nolletti Music Group Soluricom Digital Design Andre Loraleecomprised Patrick Michael Z
includes catalogue, performance schedule and reviews.
Soluri Nolletti Music Group Soluricom Digital Design Andre Loraleecomprised Patrick Michael Z
21 Clark, John
A catalogue
A catalogue of his sheet music, CDs, books, plus resume and discography.
Music Sheet Downloads Horn Quintet John French Itinerary Main Store Jazz Clark Friends Couple Area Hmm
A catalogue of his sheet music, CDs, books, plus resume and discography.
Music Sheet Downloads Horn Quintet John French Itinerary Main Store Jazz Clark Friends Couple Area Hmm
22 In Hot Pursuit of John Cusack
A catalogue
A catalogue of sites pertaining to the actor and his movies.
Cusackroman Ihave John Pursuit Unfortunately Boldffromanfcharsettimes Pleaseverdana Bolditalic}{colortblredgreenblueredgreenblueredgreenblue}marglmargrviewwviewhviewkindpardtxtxtxtxtxtxtxtxtxtxtxtxqcfbfs Times
A catalogue of sites pertaining to the actor and his movies.
Cusackroman Ihave John Pursuit Unfortunately Boldffromanfcharsettimes Pleaseverdana Bolditalic}{colortblredgreenblueredgreenblueredgreenblue}marglmargrviewwviewhviewkindpardtxtxtxtxtxtxtxtxtxtxtxtxqcfbfs Times
23 TomAdroit
A catalogue
A catalogue of animated cartoons, live action and concept photos.
Hosting Found Bluehostcom Page Might Solutions Error Affordable Name Looking Temporarily Changed Reliablewebfile
A catalogue of animated cartoons, live action and concept photos.
Hosting Found Bluehostcom Page Might Solutions Error Affordable Name Looking Temporarily Changed Reliablewebfile
24 the groover
articles, discography
articles, discography, a catalogue of bootlegs and rarities, a 'whos who,' and chat.
Bolanz
articles, discography, a catalogue of bootlegs and rarities, a 'whos who,' and chat.
Bolanz
25 Animation Portfolio Workshop
Two former
Two former instructors from Sheridan College Classical Animation offer a program in how to assemble a portfolio to enter animation school.
Found The Foundy
Two former instructors from Sheridan College Classical Animation offer a program in how to assemble a portfolio to enter animation school.
Found The Foundy
26 Hinchliffe, Robert
Catalogue of
Catalogue of compositions: a brief description of each piece, including duration and price.
Music Hinchliffe Ebooks Website New Here Oboe Chamber Wind Sheet Biography Page Ahead Played Rights Catalogue Robert Reserved
Catalogue of compositions: a brief description of each piece, including duration and price.
Music Hinchliffe Ebooks Website New Here Oboe Chamber Wind Sheet Biography Page Ahead Played Rights Catalogue Robert Reserved
27 British Films Catalogue: Bright Young Things
Synopsis and
Synopsis and production details.
British Council Directory Film United Follow Tobagotrinidad Films Page Festivals Koreasouth Koreaspainsrilankast Republiceasttimorecuadoregyptel Andbarbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanboliviabosniaand Oceanterritorybrunei Islandsuswallis News
Synopsis and production details.
British Council Directory Film United Follow Tobagotrinidad Films Page Festivals Koreasouth Koreaspainsrilankast Republiceasttimorecuadoregyptel Andbarbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanboliviabosniaand Oceanterritorybrunei Islandsuswallis News
28 jaroslavsky, andres
catalogue of
catalogue of paintings and drawings by the uk-based artist. figurative. includes cv.
Jaroslavsky Andres Drawings Paintings Catalogue Oil Art York Portrait Free Commissioned Yorkshire Portraitswebsite
catalogue of paintings and drawings by the uk-based artist. figurative. includes cv.
Jaroslavsky Andres Drawings Paintings Catalogue Oil Art York Portrait Free Commissioned Yorkshire Portraitswebsite
29 Frieseke, Frederick Carl
Information on
Information on the artist and the current catalogue raisonné project.
Hollis Taggart Error Galleries Notfound Madisonavenue Pleasesorryfound
Information on the artist and the current catalogue raisonné project.
Hollis Taggart Error Galleries Notfound Madisonavenue Pleasesorryfound
30 Silver Acre Comics
Features a
Features a large comic catalogue 1933 - 2002.
Silver Acresuperman Men Avengers Fantastic Listed Items Batman Age Four Spiderjla
Features a large comic catalogue 1933 - 2002.
Silver Acresuperman Men Avengers Fantastic Listed Items Batman Age Four Spiderjla
31 charles gilmore fine art
includes opening
includes opening hours, catalogue of works and directions.
Art Irish Gallery Fine Artists Gilmore Charles Dealers Northern Ireland Please Here Paintings Click
includes opening hours, catalogue of works and directions.
Art Irish Gallery Fine Artists Gilmore Charles Dealers Northern Ireland Please Here Paintings Click
32 Conway, Daniel
Online portfolio
Online portfolio of Daniel Conway, Washington D.C. based Scenic Designer. Site includes portfolio, biography and contact information.
Portfolio Daniel Designer Conway Scenic Dc Washington Design Web Set Sorry Based Scenery Sheets Contact Website
Online portfolio of Daniel Conway, Washington D.C. based Scenic Designer. Site includes portfolio, biography and contact information.
Portfolio Daniel Designer Conway Scenic Dc Washington Design Web Set Sorry Based Scenery Sheets Contact Website
