Topic: OR City:
Profile Page ›

JobHuntersBible.com

JobHuntersBible.com Review Experience Internet Job

Richard Bolles, the author of 'What Color is Your Parachute,' oversees this site. He includes links on jobs, resumes, research and counseling.

Hi Im Dick Bolles Im your guide to this JobHuntersBible Web site This site is designed as a supplement to my book What Color Is Your Parachute

Comment Feel free to add your comment or post!

Business Hours

Opening hours for JobHuntersBible.com ($) *

Reviews

JobHuntersBible.com JobHuntersBible.com Review › jobhuntersbible.com/index.html Statistic generated on 2024-04-16
4 SiteBook.org Points
(According to Visits for this Profile)
http://sitebook.org/review-jobhuntersbible.comindex.html.png

Address

Website
Name
JobHuntersBible.com
Street  
ZIP Code
City
Region
State
Phone No.  

Internet Job Research Hunting Boards Sites Introduction Counseling Jobs Career Parachute Engines Networking Resumes Chapter Contacts Resume Boston Color Archive Sorry Employment Careers Jobs Careers Resumes Job Hunting Career Changes Job Hunter Career Changing Changing Careers Resume Writing Online Resumes Online Jobs Online Job Hunting Parachute Book

Reviews and Comments for JobHuntersBible.com

Comment Feel free to add your comment or review!

Best entries for Internet and Job

1 InternetCap.com Internet stock
Internet stock picks, emerging internet stocks, internet stock newsletters, quotes, internet stock IPO Watch.
Domain Thema Parking Beacons Internetcapcom Programm Internet Cap Inhaber Infohtmlcategory=keyword=token= Informationen Internetcapcome Erfolgreich Htmlses=yjlptezodqwoduwodimdgnpzddcuawzxjuzxrjyxauytntizjcnwemgrjnjkumjmodmyntemzmtpptemjyxmtcnizyxnrpxnlyxjjaczkbhawawzxjuzxrjyxauytjnmmjkotmmdgmjaymmodamdmmbgfuzvhzuzgumyvpzdykeyword=token= Finden Beziehung
2 Links4News Links to
Links to a variety of news sources for internet, e-commerce, internet marketing, web development, magazines, internet statistics and other news.
News Headlines Wireless **related Marketing Internet World Tech Week Digital Broadband Media Inc Technology Crm Wi Fi Sci Today
3 Internet Marketing Resume Experienced Internet
Experienced Internet Marketing Professional looking for Internet Marketing Manager position in a progressive online company.
Sign Lifestream Everything Updated Policy Places People Aol Bulk Privacy Login Email Advertise Aolcom Now Trademarks Youre
4 WaveRider Communications Inc. Develops and
Develops and distributes network communications technology utilizing spread spectrum modems, designed to provide a communications link between Internet users and Internet providers, for primary use by Internet service providers.
5 Internet and Technology Event List Directory of
Directory of internet and computer related events.
6 biznets internet services provides consultancy
provides consultancy in web design, animation, internet promotion and e-commerce.
7 biznets internet services provides consultancy
provides consultancy in web design, animation, internet promotion and e-commerce.
Biznetscom Services Professional Recruitment Publishing Internet Media Contact Business Canada Uk Advertising Design Staff News Usa Quote
8 Media Two, LLC Internet advertising
Internet advertising agency that specializes in Internet marketing, website design.
9 Internet Star Corporation Focus: start-up
Focus: start-up and emerging stage Internet companies.
10 The Phone Man Nationwide distributors
Nationwide distributors of Internet kiosks and public Internet access terminals.
Found Apacheadditionallyport Server Found The Errordocument
11 The Insider Source for Internet Marketing Blogging by
Blogging by Ian Lee. A day in the life of an internet marketer.
12 The Internet Digest Tips on
Tips on Internet marketing, web design and small business.
13 tempo2 internet consulting
internet consulting and asset management firm, building internet businesses worldwide.
Stars Entrepreneur Chinict Tech Limited Powerpoint Rising Conference Presentation Techcrunch Tempo China Googleventure
14 Internet Video Solutions Offers hardware
Offers hardware, software, and services for setting up surveillance over the Internet.
Z Y
15 Balancing Act - African Internet Developments News about
News about Internet-related topics specific to Africa.
Africa Reports News Contact African Telecoms Broadcast Tv See Vod Digital Archives Order Huge Report Advertising Kahenya Country
16 Copy-Us Internet Musik-Verlag
Internet Musik-Verlag, publiziert die Werke von Komponisten und Komponistinnen kostenfrei im Internet.
17 Internet Farm Index Searchable database
Searchable database of over 1,000 livestock and produce farms that have Internet sites.
Ifi Uscom Here Clickz Go
18 Internet Brothers: Musings from the Cybercommunity OpEd pieces
OpEd pieces, Web site observations and future shock about the Internet and Web.
Internet Brothers Stuff Just Future Interviews Observations Masters Awards Shock Opinions Crumpled Tomato Pieces Beeline Dynamic Jenett Belesis
19 Internet Edit Editing over
Editing over the Internet. Provides business, technical and academic document proofreading, edits and rewrites.
20 software studios offers e-commerce
offers e-commerce, web development, internet marketing, and internet business strategy services.
Software Studios Film Production Ventures Joint Development Custom Contact Others Terms Great Lives Privacy Building
21 egi consulting provider of
provider of internet and electronic commerce professional services to internet-based companies and other organizations.
Engine Dotnetnuke Design Consulting Optimization Development Businesses Offers Now Texas Web Website Marketing Texasget Dallas
22 Internet Merchant Account Corpus Christi
Corpus Christi, TX agent of Texas Internet Services, ISO/MSP for Paymentech, Dallas.
23 Option Internet Freeware Options valuation
Options valuation and matrix, position chart and management, tutorial, and Internet links.
Option Options Internet Introduction Freeware Strategies Position Commodity Greeks Hedging Content Portfolio Direct Directional Equity Futures Pricing Dutch
24 sapient corporation e-services consultancy
e-services consultancy providing internet strategy consulting and sophisticated internet-based solutions.
25 Internet Ad Sales Online advertising
Online advertising network reviews and information, internet marketing tips and ad industry news.
Media Network Networks Ad Review Advertising Internet Iab Best Practices Undefined Notice Tools Video Interactive Robert
26 internet business design offers development
offers development of internet/intranet facilities and e-commerce custom database applications.
27 Paradata Systems Inc. Provides Internet
Provides Internet payment products and online credit card processing to resellers and internet merchants.
28 Audio Graphics, Inc. Originators of
Originators of RadioGraphics, using the Internet to expand radio advertising. Features broadcast related Internet statistics.
29 New Millennium Partners Investment focus:
Investment focus: early stage Internet commerce, Internet infrastructure and online media companies.
Bank Games America Cafepress Warren Buffett Partnering Blog Gets Curated Google+ Wildtangent Partners New Computer Senoff Ive Cup
30 WSI Internet Solutions Small to
Small to medium size company internet consultant opportunity. Site includes franchise request form.
31 Wright Internet Strategies Offers Internet
Offers Internet strategy, web design, flash, & search engine optimization for smaller and growing businesses.
Design Web Marketing Wright Email Branding Games Strategies Strategy Engine Website Webinteractive Contact Generation Optimization Extracurricular Interactive
32 Cobalt Group, Inc. (The) Provides internet
Provides internet marketing and data aggregation services to individual franchised dealerships, multi-franchise dealer groups and automobile manufacturers, offering web site design, development and maintenance, data extraction, aggregation and maintenance, internet advertising and promotion, and internet marketing, training and support. (Nasdaq: CBLT).
Dealer Marketing Cobalt Real Automotive Dealers News Solutions Auto Support Results Csi Websites Insights Services Medals Programs Dealership

More JobHuntersBible.com Infos

route extensions server_signature string syspathclassesresponsephp syspathclassesrequestclientinternalphp syspathclasseslogfilephp server_admin string script_filename string syspathclasseskohanaroutephp path string server syspathclasseskohanaphp syspathclasseskohanadebugphploaded syspathclassesinphp core syspathclasseskohanarequestclientphp modpathswiftmailerclassesdependency_mapscache_depsphp query_string string remote_port string syspathclasseskohanaexceptionphp syspathclasseskohanacookiephp modpathkelfinderconfigkelfinderphp syspathclasseskohanakohanaexceptionphp server_protocol string modpathswiftmailerclassesclassesswiftdependencycontainerphp request_uri string syspathclassesrequestclientphp request_time integer simplexml syspathclassesviewphp redirect_script_uri string syspathclasseslogwriterphp syspathclassesdebugphp unable docrootindexphp theuri modpathswiftmailerclassesswift_requiredphp syspathclasseskohanaconfigfilereaderphp syspathclasseskohanarequestphp script_uri string redirect_script_url string php_self string syspathclasseskohanaconfigsourcephp match indexhtml syspathclasseskohanarequestphp modpathkelfinderinitphp syspathclasseskohanalogwriterphp modpathswiftmailerclassesclassesswiftphp orig_path_info string execute uriuri syspathclassescookiephp kohana_request server_port string remote_addr string syspathclassesrequestphp syspathclasseskohanainphp modpathswiftmailerclassesswift_initphp modpathpaginationinitphp request_method string syspathclasseslogphp modpathswiftmailerclassesdependency_mapsmime_depsphp syspathclasseskohanaviewphp request_time_float float modpathswiftmailerclassesclassesswiftpreferencesphp modpathswiftmailerclassesdependency_mapstransport_depsphp modpathswiftmailerclassespreferencesphp redirect_status string syspathclassesconfigfilephp reflection modpathpaginationconfigpaginationphp modpathswiftmailerinitphp syspathclasseskohanalogphp syspathclasseskohanaconfigreaderphp server_addr string redirect_url string pdflib syspathclassesconfigphp script_url string syspathclasseskohanaconfigphp syspathviewskohanaerrorphp files phprc string port phar gateway_interface string syspathclasseskohanalogfilephp find syspathclasseskohanaconfigfilephp syspathclassesurlphp syspathclasseskohanarequestclientinternalphp server_software string syspathclasseskohanaurlphp server_name string environment apppathbootstrapphp syspathclassesroutephp syspathclasseskohanacorephp syspathclasseskohanaresponsephp modpathswiftmailerclassesmime_typesphp orig_path_translated string document_root string script_name string

Review and Opening Hours Information

If the business hours of JobHuntersBible.com in may vary on holidays like Valentine’s Day, Washington’s Birthday, St. Patrick’s Day, Easter, Easter eve and Mother’s day. We display standard opening hours and price ranges in our profile site. We recommend to check out jobhuntersbible.com/index.html for further information. You can also search for Alternatives for jobhuntersbible.com/index.html on our Review Site Sitebook.org All trademarks are the property of their respective owners. If we should delete this entry, please send us a short E-Mail.

Our Recommendations: