Topic: OR City:
Profile Page ›

Rapid Reality Studios

Rapid Reality Studios Review Experience Best Credit

Producers of QTVR panorama and object movies for interactive agencies,direct clients and CD Rom

Comment Feel free to add your comment or post!

Our Recommendations:

Business Hours

Opening hours for Rapid Reality Studios ($) *


Rapid Reality Studios Rapid Reality Studios Review Statistic generated on 2018-07-22
3 Points
(According to Visits for this Profile)


Rapid Reality Studios
ZIP Code
Phone No.  

Best Credit Phones Smart Free Pain Mortgage Construction College Popular Report Courses Luxury Rates Rapidrealitycom Legal Categories Cheap Virtual Reality QTVR And Pre-rendered VR Companies

Reviews and Comments for Rapid Reality Studios

Comment Feel free to add your comment or review!

Best entries for Best and Credit

1 Hutchins Sys-Con and Company, Inc. Offers Credit
Offers Credit Time 2000 software used for submitting credit information to the major credit bureaus.
Credit Metro Software Reporting Support Contact Pricing Bureaus Features Testimonials Lease Invoices File Industry Union Bankruptcies Consumerdata
2 Hutchins Systems Offers Credit
Offers Credit Time 2000 software used for submitting credit information to the major credit bureaus.
Credit Metro Software Reporting Support Pricing Contact Bureaus Lease Features Invoices Testimonials File Consulting Reports Upgrades Privacy
3 Better Business Partners, Inc. Produces Credit
Produces Credit Vision software which allows credit reporting agencies to process one, two or three bureau merged credit reports.
Credit Software Reporting Report Credit Screening Decisioning Tenant Mortgage Reports Bureau Union Trans Database Internet
4 Chase Credit Systems and Research Provides Internet-based
Provides Internet-based solutions for credit reporting agencies.
5 Credit Runner, Inc. Provides businesses
Provides businesses with a secure gateway to access consumer credit information via the Internet.
Credit Cards Card Best Offers Compare Reward Low Cash Interest Student Airline Instant Approval Apply
6 Credit Strategy Offers a
Offers a means of customizing and configuring Microsoft Access for use as credit management and collections software.
Credit Software Management System Strategy Deduction Collection Business Pro Demo Powerpoint Deductionmanagement They Tampa Client Theprograms
7 Information Network Provides Internet
Provides Internet and Windows based Credit Decision and Merge Credit software utilizing XML, Java II and ActiveX technologies.
8 Advantage Credit Provides custom
Provides custom software to banks and mortgage brokers for the purpose of creating in-file, merged and mortgage credit reports.
Credit Advantage Services Customer Screening Reports Login Reporting Offers Freddie Implementation Score Report Drawing Applyconnect® Automated
9 Softech Solutions, Inc. Specializes in
Specializes in credit related systems for large credit card processors including some of the largest banks, retailers, and processors in the world.
Credit Softech Vision Solutions Training Software Products Visionplus Card Paysys Applications Cards Cdm Related Cardpac Modifications Consulting W’s
10 EzVerify Software for
Software for automated processing of credit cards using the Merchant ID and bank. Turn the PC into a credit card processing terminal. Free 30-day trial. Offers information, FAQs, downloads updates, and user manual in pdf format.
Error Services Information Setup Open Product Click Page Messageslinkstasks File Foundinternet Directory Cannot
11 Softech Solutions Softech Solutions
Softech Solutions specializes in credit related systems and software, including PaySys VisionPlus, for some of the worlds largest credit card processors.
Credit Visionplus Software Paysys Solutions Cards Card Softech Experts Related Specializes Systems Largest Please Cardpac Submission Wait

Our Recommendations:

12 Desert Edge Technologies, Inc. Credit reporting
Credit reporting software for the automation of tenant screening, mortgage reporting, pre-employment screening. Access and merge all three credit bureaus.
Estate Real Desertedgecom Leading Brokers Edge Desert Realestate Net Agents Mortgageappraisals Join Management
13 Credit Management Solutions, Inc. Develops and
Develops and provides software solutions and services, including a software-based online network, for automating consumer and small business credit analysis, decisioning and funding processes. (Nasdaq: CMSS).
Cmsi Commerce Credit Financing Notice Loan Internet Application Legal Database Decision Underwriting Lending Global Banking Systems Ecommerce Financial Bb
14 Credit Management Solutions, Inc. Develops and
Develops and provides software solutions and services, including a software-based online network, for automating consumer and small business credit analysis, decisioning and funding processes. (Nasdaq: CMSS).
Cmsi Credit Commerce Application Decision Loan Notice Financing Internet Legal Database Systems Correlation Criteria Suite Fis Evaluation System
15 secure server If you
If you are taking credit/debit cards, you will need a secure ordering option on your web site. Our secure server service offers a totally safe way for your clients to send their credit/debit card details.
Secure Server Email Click Sitemaker Sitemakercom Simple Credit Here Line See Transaction Debit Forms Y
16 ezBackOffice Offers software
Offers software for deduction and credit management.
Receivable Management Collections Software Account Promises Collection Credit Ezcash Cash Collect Customer Accounts Receivables Reduces
17 GETPAID Corporation Provides credit
Provides credit collection and deductions management software.
18 Shift4 Corporation Credit card
Credit card and transaction processing applications.
Shift Processing Commerce Payment Credit Tokenization Card Gateway Partner Security Solutions Login Pospmse Third Party Processors Dollars Pci Win Secure Technology
19 CyberResources Corporation Produces CyberFinancial
Produces CyberFinancial credit collection software.
Page Cannotcloudflare Content Found Similar Found Visitsteps Missing Looking Reload
20 CardCheck Provides a
Provides a way to validate credit card numbers. By Donia Software.
Includes Canada Dsdns Dsping Digisign Cardcheck Tools Popupx Universal Commerce Inc Documentation Product Price File Transaction Idnumber Click Evaluation Universalcommerce Menu
21 MicroBilt Corporation Windows based
Windows based software for credit report retrieval.
Credit Reports Bank Data Report Business Verification Verify Searches Microbilt {see} Spot Screening Database Employment License Leader
22 Shop 4 Domain Registration without
Registration without a credit card. Reseller and affiliate program available.
Navigationshilfe Ty

Our Recommendations:

23 Allseeks A pay-per
A pay-per click search engine that offers free ppc credit to new subscribers.
24 CreditSoft Provides debt
Provides debt consolidation and management software systems for credit counseling agencies.
Debt System Software Credit Management Counseling Creditsoft Consolidation Settlement Here Loan Information Agencies Click Electronic
25 Howland International, Inc. Offers credit
Offers credit and receivables software to used car dealers and loan specialists.
Web Video Design Head Photography Production Paymentbookscom Sales International Howland Company Concordiastudioscom Shotsphotoshop
26 Cart 32 Application for
Application for Windows systems only. Integrates with Cybercash for credit card acceptance.
Cart Form Support Services Shopping Gateway Html Options Merchant Payment Wordpress Solutions Paypal Hosting Features Wwwtruck Accessoriescom Basic
27 POS Profits Offers software
Offers software for POS, accounting, inventory control and credit card processing.
Pos Aldelo Systems Choose Options Cart Point Stations Retail Cash Sale Card Add Microsoft Pro
28 Merit Systems, Inc. Sells Creditbase
Sells Creditbase software that allows businesses to access credit reports.
Credit Equifax Experian Trans Report Union Creditbase Software Reports Bureau Transunion Form System Check Windows
29 Creative Vision Studio Offers design
Offers design, and credit card processing services.
Merchant Color Bankcard Services Within Creative Pros Brochure Guide Business Studio Vision Software Beach Free Contact Long Copysuccess
30 31 Internet Solutions Services for
Services for credit unions, including web design, and website hosting.
Click Proceed Herez
31 Sonant supplies call
supplies call center automation systems: ACD, CTI, IVR, credit card payment processing
Call Center Interactive Response Management Voice Electronic Distribution Sonant Contact Corporation Computer Payment Systems Automatic Recognition Acd Automated Offered
32 Silly Traffic 10:7 exchange
10:7 exchange ratio plus 250 credit signup bonus. Earn credits from your referals.
Error Requesty

More Rapid Reality Studios Infos

portfolio bill drummond helvetica}{colortblredgreenblue}marglmargrviewwviewhviewkindpardtxtxtxtxtxtxtxtxtxtxtxtxqlqnaturalpardirnaturalffs malone

Review and Opening Hours Information

If the business hours of Rapid Reality Studios in may vary on holidays like Memorial Day, Independence Day and Labor Day, Columbus Day, Veterans Day and Thanksgiving Day. We display standard opening hours and price ranges in our profile site. We recommend to check out for further information. You can also search for Alternatives for on our Review Site All trademarks are the property of their respective owners. If we should delete this entry, please send us a short E-Mail.

Our Recommendations: