Contracting
1 Celtex Industrial Services Local Service
celtex.ca/ Industrial Services Celtex Electrical Libre Franklin Helvetica Arial Lucida Automation Us Contracting Programming Installations Consulting
219
Calgary, AB
Celtex Industrial Services: Industrial Electrical Contracting company and expert in Process Automation, PLC Programming, Electrical Installations & Consulting. We define...Calgary, AB
celtex.ca/ Industrial Services Celtex Electrical Libre Franklin Helvetica Arial Lucida Automation Us Contracting Programming Installations Consulting
2 Home Improvement Contractor - Zicklin Contracting Construction
99 wall st suite 1960, new york, ny
10005
New York
For the best Home Improvement Contractor In The New York Area, you can trust Zicklin contracting. Our track record of...New York
99 wall st suite 1960, new york, ny
1 Welcome To CarolinaSprinkler.com
Fire sprinkler
Fire sprinkler design and contracting contracting company in the southeast.
Fire Protection Sprinkler Carolina Sprinklers Automatic Safety Sc Greenville System Superior Systems Installation Premier Y
Fire sprinkler design and contracting contracting company in the southeast.
Fire Protection Sprinkler Carolina Sprinklers Automatic Safety Sc Greenville System Superior Systems Installation Premier Y
2 JB Contracting Corp.
Electrical and
Electrical and mechanical contracting corporation located in La Salle IL. specializing in commercial, industrial, and institutional projects.
Contracting Map Contact Profile Services Corporation Contractors Projects Electricalmechanical Salle Email Qualityroad Exceed
Electrical and mechanical contracting corporation located in La Salle IL. specializing in commercial, industrial, and institutional projects.
Contracting Map Contact Profile Services Corporation Contractors Projects Electricalmechanical Salle Email Qualityroad Exceed
3 Federal Contracting
Federal contracting
Federal contracting laws, regulations, legal decisions, current news and small business assistance sites.
Federal contracting laws, regulations, legal decisions, current news and small business assistance sites.
4 BJB Electrical Contracting
Providing quality
Providing quality electrical contracting services to Sydney North Shore, Australia.
Bjb Electricaly
Providing quality electrical contracting services to Sydney North Shore, Australia.
Bjb Electricaly
5 vogelbusch
consulting, engineering
consulting, engineering, know-how and contracting for the biotechnology industry. company focuses on contracting of tailormade plants based on proprietary technology and/or client technology for the sugar, starch, pharmaceutical, chemical and food industry.
Vogelbusch Plants Biotechnology Biopharma Biocommodities Engineering Website Process Go Bioprocess Technology White Austria Construction Y
consulting, engineering, know-how and contracting for the biotechnology industry. company focuses on contracting of tailormade plants based on proprietary technology and/or client technology for the sugar, starch, pharmaceutical, chemical and food industry.
Vogelbusch Plants Biotechnology Biopharma Biocommodities Engineering Website Process Go Bioprocess Technology White Austria Construction Y
6 Hagerman General Contracting
Provides construction
Provides construction services from construction management to general contracting throughout the midwest.
Hagerman Group Construction Green Design Building Portfolio Planning Energy Clients Testimonials Careers Indiana Education Management Build Differentiators Self Performance
Provides construction services from construction management to general contracting throughout the midwest.
Hagerman Group Construction Green Design Building Portfolio Planning Energy Clients Testimonials Careers Indiana Education Management Build Differentiators Self Performance
7 Witherspoon Contracting Co. of Mobile
Witherspoon Contracting
Witherspoon Contracting provides horizontal directional drilling services all along the gulf coast. We serve the local communities of Mobile, Saraland, Theodore, Daphne, Fairhope, Spanish Fort, and Bay Minette as well the rest of Alabama and the surrounding states of Mississippi, Louisiana, Florida, Georgia, and Tennessee.
Witherspoon Contracting provides horizontal directional drilling services all along the gulf coast. We serve the local communities of Mobile, Saraland, Theodore, Daphne, Fairhope, Spanish Fort, and Bay Minette as well the rest of Alabama and the surrounding states of Mississippi, Louisiana, Florida, Georgia, and Tennessee.
8 cando contracting ltd.
railroad contractors.
railroad contractors.
Services Rail Railway Cando Transload Line Short Mechanical Material Sales Engineering Storage Operations Industrial Track Contact
railroad contractors.
Services Rail Railway Cando Transload Line Short Mechanical Material Sales Engineering Storage Operations Industrial Track Contact
9 Greyback Construction Ltd.
General Contracting
General Contracting services.
General Contracting services.
10 AEG, Inc.
Offer consulting
Offer consulting and contracting IT/Engineering services.
Offer consulting and contracting IT/Engineering services.
11 Spectron Electric
Specialize in
Specialize in commercial and industrial electrical contracting.
Specialize in commercial and industrial electrical contracting.
12 Nexeon International Corporation
Contracting and
Contracting and consulting in applications maintenance and support.
Contracting and consulting in applications maintenance and support.
13 the westwind group inc.
provides consulting
provides consulting and contracting services to the nuclear and manufacturing industries.
Westwind Training Group Development Support Management Government Energy New Industries Services Manufacturing Pennsylvania Technical Jersey Learning York Lms
provides consulting and contracting services to the nuclear and manufacturing industries.
Westwind Training Group Development Support Management Government Energy New Industries Services Manufacturing Pennsylvania Technical Jersey Learning York Lms
14 Wright Way Contracting
Builder of
Builder of custom and modular homes, based in Ohio.
Builder of custom and modular homes, based in Ohio.
15 Contractors Zone
Where contracting
Where contracting professionals find information and everyone else finds out about construction.
Where contracting professionals find information and everyone else finds out about construction.
16 Osborne Electric Company
Its the
Its the service that counts. Commercial and industrial electrical contracting.
Electric Osborne Welcome Page Newer Capabilities Osborne Requires Capabilities Project Generators Version Media Oklahoma References Adobe Serviceto
Its the service that counts. Commercial and industrial electrical contracting.
Electric Osborne Welcome Page Newer Capabilities Osborne Requires Capabilities Project Generators Version Media Oklahoma References Adobe Serviceto
17 Allied General Contracting, Inc.
National construction
National construction solution for your industrial and commercial development.
National construction solution for your industrial and commercial development.
18 Southeast Electric Inc.
Electrical contracting
Electrical contracting and telecommunication infrastructures for the greater Nashville, Tennessee area.
Electrical contracting and telecommunication infrastructures for the greater Nashville, Tennessee area.
19 Alternet Ltd
Provides Payroll
Provides Payroll Services to contracting individuals in the UK, we are an Inland Revenue approved solution to IR35.
Provides Payroll Services to contracting individuals in the UK, we are an Inland Revenue approved solution to IR35.
20 Top Echelon Contracting
A full
A full service back-office provider and can become the legal W-2 Employer of Record.
A full service back-office provider and can become the legal W-2 Employer of Record.
21 Apexa Enterprises
Consultancy, contracting
Consultancy, contracting and trading in industrial and environmental engineering and thermal insulation.
Consultancy, contracting and trading in industrial and environmental engineering and thermal insulation.
22 Carrano Air Contracting, Inc.
Full service
Full service residential/commercial HVAC contractor based in Dayton, NJ.
Heating Conditioning Aircontracting Carrano Air Services County Residential Commercial Contractor Repair Maintenance Hvac Brunswick Efficiency Safety Berkeley Contractors Certified
Full service residential/commercial HVAC contractor based in Dayton, NJ.
Heating Conditioning Aircontracting Carrano Air Services County Residential Commercial Contractor Repair Maintenance Hvac Brunswick Efficiency Safety Berkeley Contractors Certified
23 Boswell Contracting Inc.
Provides construction
Provides construction and fabrication of handrails, metal stairs and bill board structures.
Provides construction and fabrication of handrails, metal stairs and bill board structures.
24 hargrave electric company, inc.
a design
a design and build electrical contracting firm located in texas, usa.
Hargrave Welcome Electricy
a design and build electrical contracting firm located in texas, usa.
Hargrave Welcome Electricy
25 lge process
engineering and
engineering and contracting services to the gas, chemical and petrochemical industries worldwide. located in edinburgh, scotland.
Z Request Y
engineering and contracting services to the gas, chemical and petrochemical industries worldwide. located in edinburgh, scotland.
Z Request Y
26 Geosearch, Inc.
Full service
Full service geothermal, environmental drilling & contracting company - serving the New England area.
Hosting Domain Web Solutions Marketing Network Services Names Registration Website Helps| Innovative Go
Full service geothermal, environmental drilling & contracting company - serving the New England area.
Hosting Domain Web Solutions Marketing Network Services Names Registration Website Helps| Innovative Go
27 Safety Hoist Company
Featuring platform
Featuring platform hoists designed for professional use in contracting and masonry work.
Featuring platform hoists designed for professional use in contracting and masonry work.
28 Barton Southern Company, Inc
Conyers, Georgia
Conyers, Georgia based contracting firm specializing in infrastructure repair.
Repair Barton Southern Company Concrete Slab Inc Contractor Injection Sewer Water Infrastructure Grouting Chemical Studies Slabs Soil
Conyers, Georgia based contracting firm specializing in infrastructure repair.
Repair Barton Southern Company Concrete Slab Inc Contractor Injection Sewer Water Infrastructure Grouting Chemical Studies Slabs Soil
29 Parisharm Systems Corp
Firm servicing
Firm servicing various Fortune 500 companies in IT Professional Staffing, Outsourcing, and Contracting.
Firm servicing various Fortune 500 companies in IT Professional Staffing, Outsourcing, and Contracting.
30 The Gordian Group, Inc.
Offering a
Offering a full range of services required for the development and implementation of the Job Order Contracting system (JOC).
Order Gordian Solution Learn Joc Complete Streamlining Specialized Program Investment Process Expertise Return Development Group Best Class Leadership Unified Plus
Offering a full range of services required for the development and implementation of the Job Order Contracting system (JOC).
Order Gordian Solution Learn Joc Complete Streamlining Specialized Program Investment Process Expertise Return Development Group Best Class Leadership Unified Plus
31 University of Wisconsin-Madison
Offers seminars
Offers seminars and workshops focusing on risk, contracting and project team leadership.
Offers seminars and workshops focusing on risk, contracting and project team leadership.
32 TerraSystems, Inc.
A geotechnical
A geotechnical contracting firm specializing in dynamic compaction, wick drains, vibrocompaction and stone columns.
Terrasystems Compaction Dynamic Equipment Services Wick Drains Columns News Geotechnical Stone Contact Studies Password Lauderdale Main Soil Fort
A geotechnical contracting firm specializing in dynamic compaction, wick drains, vibrocompaction and stone columns.
Terrasystems Compaction Dynamic Equipment Services Wick Drains Columns News Geotechnical Stone Contact Studies Password Lauderdale Main Soil Fort
33 Divane Bros. Electric Company
Illinois based
Illinois based provider of quality electrical contracting services since 1922.
Illinois based provider of quality electrical contracting services since 1922.
34 Whiting-Turner Contracting Company
Licensed to
Licensed to do business and routinely completes work in most of the continental United States.
Licensed to do business and routinely completes work in most of the continental United States.
35 Breen and Associates
A government
A government contracting sales consultant with experience in the manufacturing, consulting, service, and retail sectors.
Breen Group Consulting Contract Business Development Government Veteran Sales Owned Contracts Disabled President Seminars Areas Aboutus Northeast
A government contracting sales consultant with experience in the manufacturing, consulting, service, and retail sectors.
Breen Group Consulting Contract Business Development Government Veteran Sales Owned Contracts Disabled President Seminars Areas Aboutus Northeast
36 technology contracting
specializes in
specializes in the consultation and installation of professional and consumer audio, video, lighting, and personal computers.
Web Please Free Wwwtechnologycontractingcom Thanks Hosting Waitnote Page High Commerce Click Speed Yes
specializes in the consultation and installation of professional and consumer audio, video, lighting, and personal computers.
Web Please Free Wwwtechnologycontractingcom Thanks Hosting Waitnote Page High Commerce Click Speed Yes
37 Terra Nova Industries
General contracting
General contracting, construction management, development & design, contact information on site.
General contracting, construction management, development & design, contact information on site.
38 Wayne J. Griffin Electric, Inc.
Founded in
Founded in 1978, electrical contracting firm that provides state-of-the-art systems to projects throughout New England and the South.
Founded in 1978, electrical contracting firm that provides state-of-the-art systems to projects throughout New England and the South.
39 Federal Contract Consultants
New York
New York based consultancy guides clients through all phases of contracting and selling to government agencies.
Žd–yÂÂ@Ã…Â c‘n Æ’jÆ’lÆ’r ‚É‚«Ã¢â‚¬Å¡ÑÂÂÕ‚ÌÂÂÔÃ¢â‚¬Å¡Ý Ã¢â‚¬Å¡É‚«Ã¢â‚¬Å¡ÑÂÂÕ‚ÌÂÂÔ‚Ý‚ÌÆ’pÆ’a ‚É‚«Ã¢â‚¬Å¡ÑÂÂÕ‚ÌÂÂÔ‚Ý‚ÌŽ¡Ã¢â‚¬â€Ã Žd–y®‘̉@ ÂÂ… ˆâ•i®â€â€Ã‚ÂÂÂ@Žd–y Å’ð’ÊŽ–ŒÌŽ¡Ã¢â
New York based consultancy guides clients through all phases of contracting and selling to government agencies.
Žd–yÂÂ@Ã…Â c‘n Æ’jÆ’lÆ’r ‚É‚«Ã¢â‚¬Å¡ÑÂÂÕ‚ÌÂÂÔÃ¢â‚¬Å¡Ý Ã¢â‚¬Å¡É‚«Ã¢â‚¬Å¡ÑÂÂÕ‚ÌÂÂÔ‚Ý‚ÌÆ’pÆ’a ‚É‚«Ã¢â‚¬Å¡ÑÂÂÕ‚ÌÂÂÔ‚Ý‚ÌŽ¡Ã¢â‚¬â€Ã Žd–y®‘̉@ ÂÂ… ˆâ•i®â€â€Ã‚ÂÂÂ@Žd–y Å’ð’ÊŽ–ŒÌŽ¡Ã¢â
40 DCD Insurance Services
offers agriculture
offers agriculture, food processing, property management, wholesale distributors, retail, service, contracting, and trucking.
Insurance Business Agency Privacy Dcd Financial Policy Services Property Personal Offering Full Consumer Commercial Benefits
offers agriculture, food processing, property management, wholesale distributors, retail, service, contracting, and trucking.
Insurance Business Agency Privacy Dcd Financial Policy Services Property Personal Offering Full Consumer Commercial Benefits
41 Online Permit Authority, Inc.
Provides building
Provides building permitting services on a national level to retailers, architectural, engineering and general contracting companies.
Provides building permitting services on a national level to retailers, architectural, engineering and general contracting companies.
42 LAF Group
Provides mineral
Provides mineral based fire protection systems using vermiculite, perlite, and their derivatives. Also has contracting division. Located in Greenacre, NSW, Australia.
Fire Protection System Passive Vermiculite Perlite Systems Landmark Abatement Group_noise Laf Construction Page
Provides mineral based fire protection systems using vermiculite, perlite, and their derivatives. Also has contracting division. Located in Greenacre, NSW, Australia.
Fire Protection System Passive Vermiculite Perlite Systems Landmark Abatement Group_noise Laf Construction Page
43 Online Permit Authority, Inc.
Provides building
Provides building permitting services on a national level to retailers, architectural, engineering and general contracting companies.
Provides building permitting services on a national level to retailers, architectural, engineering and general contracting companies.
44 Hayward Baker
National contracting
National contracting firm, headquartered in Odenton, specializing in site improvement and foundation work for construction projects.
Baker Grouting Hayward Piles Soil Compaction Ground Vibro Geotechnical Construction Structural Earth Contractors Support Stabilization Walls Slide Rapid Maryland
National contracting firm, headquartered in Odenton, specializing in site improvement and foundation work for construction projects.
Baker Grouting Hayward Piles Soil Compaction Ground Vibro Geotechnical Construction Structural Earth Contractors Support Stabilization Walls Slide Rapid Maryland
45 Putnam Contracting Incorporated
Design and
Design and install tennis courts and supply related equipment. Includes an overview of products and services.
Design and install tennis courts and supply related equipment. Includes an overview of products and services.
46 aloha systems, inc.
contracting, engineering
contracting, engineering, and consulting firm specializing in dsm measurement and verification, power quality enhancement, and rate optimization.
contracting, engineering, and consulting firm specializing in dsm measurement and verification, power quality enhancement, and rate optimization.
47 General Excavating
Lincoln, Nebraska
Lincoln, Nebraska based contracting firm which provides construction services for utility, environmental, communications and dredging projects.
Excavating General Utilities Excavation Hydro Cornhusker Enews Policy Work Tight Privacy News Spot Partner Hydroexcavation Hwy
Lincoln, Nebraska based contracting firm which provides construction services for utility, environmental, communications and dredging projects.
Excavating General Utilities Excavation Hydro Cornhusker Enews Policy Work Tight Privacy News Spot Partner Hydroexcavation Hwy
48 mobimar ltd.
manufactures tour
manufactures tour submarines and surface vessels. features company and services overview, 3d and sub-contracting experience. [turku, finland]
manufactures tour submarines and surface vessels. features company and services overview, 3d and sub-contracting experience. [turku, finland]
49 theta services
offering advice
offering advice for offshore marine operations including vessel surveys, audits, tow contracting, heavy lifting.
Theta Services Vessel Offshore Marine Kohli Engineering Oil Surveyors Diving Consultants Contact Capabilities Rig Auditors Contracting Uk Surveyor
offering advice for offshore marine operations including vessel surveys, audits, tow contracting, heavy lifting.
Theta Services Vessel Offshore Marine Kohli Engineering Oil Surveyors Diving Consultants Contact Capabilities Rig Auditors Contracting Uk Surveyor
50 Robert A. Crystal, CPA
Provides accounting
Provides accounting services to small and medium size businesses in construction contracting, real estate, and professional service industries.
Provides accounting services to small and medium size businesses in construction contracting, real estate, and professional service industries.
51 b & c contracting, inc.
florida, us
florida, us general contractor offering complete construction services for the wireless industry including tower erection, modifications, and maintenance.
florida, us general contractor offering complete construction services for the wireless industry including tower erection, modifications, and maintenance.
52 UCI Underground Contractors Inc.
Based in
Based in Wixom, Michigan. Services customers throughout the United States providing turnkey solutions to a wide range of contracting needs.
Based in Wixom, Michigan. Services customers throughout the United States providing turnkey solutions to a wide range of contracting needs.
53 Tsurumi Manufacturing Co., Ltd.
Manufacturers of
Manufacturers of electrical submersible pumps for contracting, sewage, and industrial applications. Includes diagrams and specifications. Located in Germany.
Manufacturers of electrical submersible pumps for contracting, sewage, and industrial applications. Includes diagrams and specifications. Located in Germany.
54 Rosenlund Group
Provides services
Provides services for high reach demolition, civil contracting and roadworks around Australia. Includes project information and staffing details.
Provides services for high reach demolition, civil contracting and roadworks around Australia. Includes project information and staffing details.
55 Smith, Victoria
Hot rock
Hot rock photography, fashion and portraits. Primarily documenting the San Francisco music scene, and contracting to worldwide publications, agencies and individuals.
Z Gallery Y
Hot rock photography, fashion and portraits. Primarily documenting the San Francisco music scene, and contracting to worldwide publications, agencies and individuals.
Z Gallery Y
56 mark snyder electric
alternative energy
alternative energy products and services such as electrical contracting, solar panels, power generators, batteries, windmills, and books.
Mark Repairs Snyder Electric Hours Automation Electrical Installations Blog Self Insteon County Projects Troubleshooting Diego Faqs Written Energy
alternative energy products and services such as electrical contracting, solar panels, power generators, batteries, windmills, and books.
Mark Repairs Snyder Electric Hours Automation Electrical Installations Blog Self Insteon County Projects Troubleshooting Diego Faqs Written Energy
57 The Quandel Group, Inc.
Specializes in
Specializes in providing design and build, construction management, and general contracting services in the Mid-Atlantic and Midwest Regions of the United States.
Specializes in providing design and build, construction management, and general contracting services in the Mid-Atlantic and Midwest Regions of the United States.
58 Industrial Communications and Electronics, Inc.
Offers full-service
Offers full-service tower contracting and antenna site leasing and management. Provides an overview of services and employment opportunities .
Offers full-service tower contracting and antenna site leasing and management. Provides an overview of services and employment opportunities .
59 Crownover Consulting
Consultant specializing
Consultant specializing in proposal writing, government contracting, project management, logistics support analysis, technical documentation, ISO 9000.
Consultant specializing in proposal writing, government contracting, project management, logistics support analysis, technical documentation, ISO 9000.
60 Vanman Companies
Minnesota firm
Minnesota firm specializing in religious building projects by offering design/build, construction management and general contracting services.
Movedpermanently The Port Apacheserver
Minnesota firm specializing in religious building projects by offering design/build, construction management and general contracting services.
Movedpermanently The Port Apacheserver
61 Kearney Electric, Inc
An electrical
An electrical contracting company based in Phoenix AZ. Choose KEI for your design build/construction team and add superior quality, commitment, and professionalism.
An electrical contracting company based in Phoenix AZ. Choose KEI for your design build/construction team and add superior quality, commitment, and professionalism.
62 Landau Associates, Inc.
A full
A full service geotechnical contracting company which provides environmental assessment services. Offices in Edmonds, Portland, Spokane, Tacoma and Kennewick.
A full service geotechnical contracting company which provides environmental assessment services. Offices in Edmonds, Portland, Spokane, Tacoma and Kennewick.
63 McDaniel Contracting Inc
Atlanta Georgia
Atlanta Georgia area - offering services to real estate agents and mortgage brokers who specialize in REO, distressed and foreclosed properties.
Atlanta Georgia area - offering services to real estate agents and mortgage brokers who specialize in REO, distressed and foreclosed properties.
64 The Reybold Group
Providing real
Providing real estate services, general contracting, modular and mobile housing to the Delaware Valley. Includes community information.
Reybold Group Commercial Construction Residential Delaware Selfstorage Scotland Valley Quality Differenceweconceive Contact Specials
Providing real estate services, general contracting, modular and mobile housing to the Delaware Valley. Includes community information.
Reybold Group Commercial Construction Residential Delaware Selfstorage Scotland Valley Quality Differenceweconceive Contact Specials
65 Flo-Tron Contracting, Inc.
Provides heating
Provides heating, ventilation and air conditioning of mechanical systems as well as process piping. Services include plumbing, design, installation and inspections. US based (MD).
Provides heating, ventilation and air conditioning of mechanical systems as well as process piping. Services include plumbing, design, installation and inspections. US based (MD).
66 Anderson Lumber Company
Operate roof
Operate roof and floor truss component plants in the intermountain west. Offer project packages and contracting services.
Operate roof and floor truss component plants in the intermountain west. Offer project packages and contracting services.
67 Integrated Electrical Services, Inc.
Provides electrical
Provides electrical contracting solutions in the United States. [NYSE:IES]
Provides electrical contracting solutions in the United States. [NYSE:IES]
68 KRE Engineering
Pipeline rehabilitation
Pipeline rehabilitation systems designed specifically for the contracting rehabilitation industry.
Pipeline rehabilitation systems designed specifically for the contracting rehabilitation industry.
69 VersaTool&Die Machining and Engineering
Specializing in
Specializing in progressive dies, precision machining, CNC contracting and EDM.
Quality Tool Edmcnc Samples Cadcam Contact Machining Prec Map Produce Tooling Error Partspolicy
Specializing in progressive dies, precision machining, CNC contracting and EDM.
Quality Tool Edmcnc Samples Cadcam Contact Machining Prec Map Produce Tooling Error Partspolicy
70 Eichleay
Multi-discipline engineering
Multi-discipline engineering, facilities engineering, design and contracting services.
Multi-discipline engineering, facilities engineering, design and contracting services.
71 Mortgage Contracting Services
US-wide -
US-wide - property inspection and preservation services.
Z Mcsnowcom Y
US-wide - property inspection and preservation services.
Z Mcsnowcom Y
72 Contractors World Wide
A very
A very comprehensive list of categories of contracting and contractors
Z Y
A very comprehensive list of categories of contracting and contractors
Z Y
73 DEC Electrical Engineering
An electrical
An electrical contracting company active through Turkey and in the CIS countries.
Facilities Design Contracting Hotels Project Residences Centers Industrial Activities Sports Educational Airports Houses Business Shopping Please Line Consulting
An electrical contracting company active through Turkey and in the CIS countries.
Facilities Design Contracting Hotels Project Residences Centers Industrial Activities Sports Educational Airports Houses Business Shopping Please Line Consulting
74 firstech environmental, inc.
a full-service
a full-service environmental consulting and contracting company.
Z Y
a full-service environmental consulting and contracting company.
Z Y
75 Medical Contracting Service Inc.
Specializes in
Specializes in contract placement of medical professionals.
Specializes in contract placement of medical professionals.
76 Tri Star Engineering
Military contracting
Military contracting, commercial engineering, and cable construction.
Star Engineering Seaport Inc Tri Systems Contact Careers Services Team Customers Support Vehicles Teamed Business Warfare Management Small
Military contracting, commercial engineering, and cable construction.
Star Engineering Seaport Inc Tri Systems Contact Careers Services Team Customers Support Vehicles Teamed Business Warfare Management Small
77 Greyback Construction
General contracting
General contracting, engineering, and construction management services located in Penticton, BC.
General contracting, engineering, and construction management services located in Penticton, BC.
78 Planit Construction Company Inc.
UK general
UK general contracting, construction management and design/build firm.
Inc Intro Planity
UK general contracting, construction management and design/build firm.
Inc Intro Planity
79 Mistral Security Inc.
Security products
Security products, contracting, and program management for government, defense, and commercial use.
Security products, contracting, and program management for government, defense, and commercial use.
80 Engineers Construction, Inc.
Offers general
Offers general construction and contracting services. South Burlington, Vermont.
Eci Engineers Construction Acquires Projects Employment Safety Login Award Services Esgr Bridge Michael Semi Finalist Years Nominated Witch Directional Completes Span
Offers general construction and contracting services. South Burlington, Vermont.
Eci Engineers Construction Acquires Projects Employment Safety Login Award Services Esgr Bridge Michael Semi Finalist Years Nominated Witch Directional Completes Span
81 Kelsey Construction, Inc.
General contracting
General contracting and construction management services. Southeastern United States.
Diams Construction Kelsey Projects Licenses Retail Inc Office State Interiors Parking Roads Apartments Churches Entertainment Public Garages Industrial System
General contracting and construction management services. Southeastern United States.
Diams Construction Kelsey Projects Licenses Retail Inc Office State Interiors Parking Roads Apartments Churches Entertainment Public Garages Industrial System
82 dredging news online
international dredging
international dredging industry, ports and harbours, and marine contracting.
international dredging industry, ports and harbours, and marine contracting.
83 Waypoint Engineering
Contracting and
Contracting and engineering services for domestic and international product development groups.
Contracting and engineering services for domestic and international product development groups.
84 Contractor Magazine
A news
A news magazine of mechanical contracting, with articles on plumbing, hydronics, and hvac.
A news magazine of mechanical contracting, with articles on plumbing, hydronics, and hvac.
85 Professional Tax Contracting Services
Sales and
Sales and Use Tax compliance services including return preparation, and nexus studies.
Services Professional Sales Contracting Taxcompliance Ptcs Contact Tax Quote Quick Website Profile Creditdocumentation Use Copyright
Sales and Use Tax compliance services including return preparation, and nexus studies.
Services Professional Sales Contracting Taxcompliance Ptcs Contact Tax Quote Quick Website Profile Creditdocumentation Use Copyright
86 AgraMarke
Providing business
Providing business agricultural services such as contracting for specific farmland in midwest for specific production.
Providing business agricultural services such as contracting for specific farmland in midwest for specific production.
87 Timbaigl Optics
Contracting services
Contracting services in optical and optical fibre research and development, optomechanical design.
Contracting services in optical and optical fibre research and development, optomechanical design.
88 Telstar Construction Company, Inc.
Provides general
Provides general contracting in New Mexico and Arizona, specializing in commercial and industrial construction.
Provides general contracting in New Mexico and Arizona, specializing in commercial and industrial construction.
89 Higgins and Associates Investigative Services
Licensed private
Licensed private investigator. Includes services and contracting information.
Licensed private investigator. Includes services and contracting information.
90 les darker electrical
n.i.c.e.i.c., a
n.i.c.e.i.c., a electrical contracting business near the town of ross on wye
n.i.c.e.i.c., a electrical contracting business near the town of ross on wye
91 Consolidated Management Company
Food service
Food service contracting company.
Management Consolidated Food Company Information Services Foodservice Cafeteria Outsource Nutritional Minnesota Illinois Kansas Companies Quote Wisconsin College
Food service contracting company.
Management Consolidated Food Company Information Services Foodservice Cafeteria Outsource Nutritional Minnesota Illinois Kansas Companies Quote Wisconsin College
92 Shell Building Systems
Providing foam
Providing foam core panel contracting, design and installation services to homeowners and architects. Serving California and Hawaii since 1979.
Sips Systems Shell Building Design Questions Code Information Frequent Report Technical Team Benefits School Gallery Phone Value Shellbuilding Request Premier
Providing foam core panel contracting, design and installation services to homeowners and architects. Serving California and Hawaii since 1979.
Sips Systems Shell Building Design Questions Code Information Frequent Report Technical Team Benefits School Gallery Phone Value Shellbuilding Request Premier
93 Broussard Iron Works
Offers machining
Offers machining services to farming, fishing, oilfield, and general contracting industries. Provides company background, goals, and awards pages.
Offers machining services to farming, fishing, oilfield, and general contracting industries. Provides company background, goals, and awards pages.
94 J. Freeman, Inc
Distributor of
Distributor of plexiglas, velcro, silicone and cutting boards. Supplies and equipment for the sign, graphic arts, printing, display, architecture, and contracting industries.
Sign Velcro Silicone Freeman Boards Inc Cutting Lease Plexiglas Materials Graphic Aluminum Contact Plastic Wrap Ma
Distributor of plexiglas, velcro, silicone and cutting boards. Supplies and equipment for the sign, graphic arts, printing, display, architecture, and contracting industries.
Sign Velcro Silicone Freeman Boards Inc Cutting Lease Plexiglas Materials Graphic Aluminum Contact Plastic Wrap Ma
95 AD Display Sign Systems, Inc
Outdoor and
Outdoor and indoor business signage including electric signs, interior graphics, and awnings. Nationwide contracting, based in Katy, TX.
Participate Beta Signsmart Permanently The Openssl Fipsmod_auth_passthrough Serverat Code Plan Testsign Apache Port
Outdoor and indoor business signage including electric signs, interior graphics, and awnings. Nationwide contracting, based in Katy, TX.
Participate Beta Signsmart Permanently The Openssl Fipsmod_auth_passthrough Serverat Code Plan Testsign Apache Port
96 The Mabetex Group
Engineering and
Engineering and general contracting. Projects include public and residential building, airports and industrial plants. Includes project image gallery.
Engineering and general contracting. Projects include public and residential building, airports and industrial plants. Includes project image gallery.
97 Parra Design Group, Ltd.
Architectural design
Architectural design, general construction contracting, urban and space planning. Houston.
Houston Townhomes House Parra Design Sale New Townhouses Group Contemporary Construction Ltd Architects Upper Yupon Promenade Team
Architectural design, general construction contracting, urban and space planning. Houston.
Houston Townhomes House Parra Design Sale New Townhouses Group Contemporary Construction Ltd Architects Upper Yupon Promenade Team
98 sacal environmental & management co.
a full
a full service environmental consulting and contracting corporation located in macon georgia.
a full service environmental consulting and contracting corporation located in macon georgia.
99 Alabama Metal Fabricators, Inc
Established in
Established in 1995, company is composed of a Fabrication Division, along with a Mechanical Contracting Division.
Alabama Safety Fabricators Metal Contact Field Construction Fabrication History Progress Work Equipment Licensing Inc Award
Established in 1995, company is composed of a Fabrication Division, along with a Mechanical Contracting Division.
Alabama Safety Fabricators Metal Contact Field Construction Fabrication History Progress Work Equipment Licensing Inc Award
100 Jorgensen Contracting, Inc
Builds post
Builds post framed wick buildings and all steel commander buildings in Nebraska and Iowa.
Builds post framed wick buildings and all steel commander buildings in Nebraska and Iowa.
101 north mississippi utility services contracting
electric, gas
electric, gas, and water meter reading. services and contact information.
Bone Blog Pricing Webspawner Real Collector Deer Work Farmer Faqs Privacy Features Terms Sites Career
electric, gas, and water meter reading. services and contact information.
Bone Blog Pricing Webspawner Real Collector Deer Work Farmer Faqs Privacy Features Terms Sites Career
102 McCarls, Inc.
Mechanical Contracting
Mechanical Contracting, Industrial and Commercial, including plumbing and mechanical, for schools, prisons, hospitals, and universities.
Shale Industrial Construction Mccarls Contractor Bull Fabrication Maintenance Chemicals Manufacturing Treatment Commitment Employment American Intranet Piping Pricing Pipe They
Mechanical Contracting, Industrial and Commercial, including plumbing and mechanical, for schools, prisons, hospitals, and universities.
Shale Industrial Construction Mccarls Contractor Bull Fabrication Maintenance Chemicals Manufacturing Treatment Commitment Employment American Intranet Piping Pricing Pipe They
103 Miller Pipeline Corp.
Contracting firm
Contracting firm with territorial rights to the EX-pipe and AmEx pipe rehabilitation technologies.
Contracting firm with territorial rights to the EX-pipe and AmEx pipe rehabilitation technologies.
104 Miller Pipeline Corp.
Contracting firm
Contracting firm with territorial rights to the EX-pipe and AmEx pipe rehabilitation technologies.
Contracting firm with territorial rights to the EX-pipe and AmEx pipe rehabilitation technologies.
105 Miller Pipeline Corp.
Contracting firm
Contracting firm with territorial rights to the EX-pipe and AmEx pipe rehabilitation technologies.
Contracting firm with territorial rights to the EX-pipe and AmEx pipe rehabilitation technologies.
106 Miller Pipeline Corp.
Contracting firm
Contracting firm with territorial rights to the EX-pipe and AmEx pipe rehabilitation technologies.
Seal President Benefits Miller Vice Weko Vacuum Excavation Pipeline Specifications Safe Services Cipp Distribution Pipelines
Contracting firm with territorial rights to the EX-pipe and AmEx pipe rehabilitation technologies.
Seal President Benefits Miller Vice Weko Vacuum Excavation Pipeline Specifications Safe Services Cipp Distribution Pipelines
107 JKJ Electric
Electrical contractor
Electrical contractor - providing professional electrical repair and home improvements. Contracting throughout Maryland for over 10 Years.
Electrical contractor - providing professional electrical repair and home improvements. Contracting throughout Maryland for over 10 Years.
108 Walter R. Goodman Company
Offer a
Offer a full service general contracting service for the erection of steel buildings.
Z Steelmetalbuildingscom Y
Offer a full service general contracting service for the erection of steel buildings.
Z Steelmetalbuildingscom Y
109 Power Mac Industries
Services and
Services and rebuilds all types of industrial equipment as well as offering commercial and industrial electrical contracting.
Services and rebuilds all types of industrial equipment as well as offering commercial and industrial electrical contracting.
110 Virginia Contracting Services
Virginia and
Virginia and Maryland - property preservation, eviction assistance, lock changes and minor rehab.
Virginia and Maryland - property preservation, eviction assistance, lock changes and minor rehab.
111 Medical Devices Consulting
Regulatory affairs
Regulatory affairs, quality assurance, custom software, and compliance contracting and consulting services.
Medical Device Forum Forgot Quality Rules Consulting Weisenborn Affairs Password Create Help Qsr Fda Assurance Account Topics
Regulatory affairs, quality assurance, custom software, and compliance contracting and consulting services.
Medical Device Forum Forgot Quality Rules Consulting Weisenborn Affairs Password Create Help Qsr Fda Assurance Account Topics
112 Sanford Contracting
Pioneer throughout
Pioneer throughout the northeast in light metal framing. The Sanford family has been involved in commercial construction for over 85 years.
Systems Sanford Light Gauge Wall Design Contracting Stone Cold Prefabricated Rainscreens Unitized Granite Trusses Brick Roof Benefits Inc Projects Eifs
Pioneer throughout the northeast in light metal framing. The Sanford family has been involved in commercial construction for over 85 years.
Systems Sanford Light Gauge Wall Design Contracting Stone Cold Prefabricated Rainscreens Unitized Granite Trusses Brick Roof Benefits Inc Projects Eifs
113 Waldos Electric Company
Electrical contracting
Electrical contracting firm with offices nationwide. All aspects of electrical wiring large or small.
Misters Blog Menuz
Electrical contracting firm with offices nationwide. All aspects of electrical wiring large or small.
Misters Blog Menuz
114 Accord Communication
Providing services
Providing services in setup of OFC Networks (Optical Fiber Cables), engineering and contracting, trenching, laying, ducting and turnkey installations of CDMA towers.
Providing services in setup of OFC Networks (Optical Fiber Cables), engineering and contracting, trenching, laying, ducting and turnkey installations of CDMA towers.
115 QTC Limited
Also providing
Also providing contracting services for the commercial industries and club house. Includes portfolio, firm profile, and contact information. Located in Hong Kong, China.
Also providing contracting services for the commercial industries and club house. Includes portfolio, firm profile, and contact information. Located in Hong Kong, China.
116 carpetcycle llc
usa. provides
usa. provides solutions for the removal, collection, tear-out contracting and recycling of post consumer carpet. includes profile, services offered, request a quote and contact details.
usa. provides solutions for the removal, collection, tear-out contracting and recycling of post consumer carpet. includes profile, services offered, request a quote and contact details.
117 Fru-Con Engineering Corporation
Offer a
Offer a range of services including construction, design and build, and management contracting . Company history, news and career opportunities, and a project portfolio .
Offer a range of services including construction, design and build, and management contracting . Company history, news and career opportunities, and a project portfolio .
118 Accord Communication
Providing services
Providing services in setup of OFC Networks (Optical Fiber Cables), engineering and contracting, trenching, laying, ducting and turnkey installations of CDMA towers.
Parallels Plesk Panel Page Virtuozzo Windows Default Automation Containers Workstation Linux Panel For Learnmore Leadinghosting Page This
Providing services in setup of OFC Networks (Optical Fiber Cables), engineering and contracting, trenching, laying, ducting and turnkey installations of CDMA towers.
Parallels Plesk Panel Page Virtuozzo Windows Default Automation Containers Workstation Linux Panel For Learnmore Leadinghosting Page This
119 anderson coach and travel
charter bus
charter bus services, sightseeing tours and school bus contracting. includes information on tours, charters, and employment.
Travel Coach Bus Motorcoach Anderson Tours Charter Group Certificates Join Trips Tour Gift Information Directors Mailing Sightseeing Own
charter bus services, sightseeing tours and school bus contracting. includes information on tours, charters, and employment.
Travel Coach Bus Motorcoach Anderson Tours Charter Group Certificates Join Trips Tour Gift Information Directors Mailing Sightseeing Own
120 cmh environmental group
environmental consulting
environmental consulting and contracting company specializing in water treatment, hazardous waste, bioremediation and site restoration.
environmental consulting and contracting company specializing in water treatment, hazardous waste, bioremediation and site restoration.
121 Mcmusa, Inc.
Full-service general
Full-service general contracting firm offering architectural and construction services. Contains descriptions of services and images of examples.
Contact Cannoterrorproviderfor Page Please Displayed
Full-service general contracting firm offering architectural and construction services. Contains descriptions of services and images of examples.
Contact Cannoterrorproviderfor Page Please Displayed
122 Landau Associates, Inc.
A full
A full service geotechnical contracting company which provides environmental assessment services. Landau has trenchless new construction experience.
A full service geotechnical contracting company which provides environmental assessment services. Landau has trenchless new construction experience.
123 mccue environmental contracting
specializing in
specializing in the installation and maintenance of remediation systems designed for the in situ treatment of soil and groundwater treatment.
specializing in the installation and maintenance of remediation systems designed for the in situ treatment of soil and groundwater treatment.
124 GW Construction, Inc
General contracting
General contracting company specializing in the fabrication and installation of process piping, related process equipment, tanks and associated structures.
Construction Facilitiesprojects Project Pipeline Terminal Copyright Office Nothing Services Protection Found Apologies Procedures Fostertechnology
General contracting company specializing in the fabrication and installation of process piping, related process equipment, tanks and associated structures.
Construction Facilitiesprojects Project Pipeline Terminal Copyright Office Nothing Services Protection Found Apologies Procedures Fostertechnology
125 Dowdeswell Forestry Management
Providing forest
Providing forest and woodland management, advice and contracting services. Covers central and southern England and Wales.
Providing forest and woodland management, advice and contracting services. Covers central and southern England and Wales.
126 saberprobe llc
based in
based in omaha, ne, providing a staff of environmental, geotechnical, and geology professionals providing direct push geoservices and drilling contracting.
based in omaha, ne, providing a staff of environmental, geotechnical, and geology professionals providing direct push geoservices and drilling contracting.
127 Structure Tone Inc.
Provides project
Provides project management, construction management and general contracting services .Career opportunities, locations and links to industry resources .
Provides project management, construction management and general contracting services .Career opportunities, locations and links to industry resources .
128 TECNY Group Inc.
A full
A full service design and build firm providing design, construction management and general contracting. Located in New York, NY.
A full service design and build firm providing design, construction management and general contracting. Located in New York, NY.
129 Krill Construction
Providing services
Providing services including commercial and residential design-build, historic restoration, construction management, and general contracting.
Krill Construction Management General Contracting Design Build Inc Co Ohio Services Careers Architects Notes Projects
Providing services including commercial and residential design-build, historic restoration, construction management, and general contracting.
Krill Construction Management General Contracting Design Build Inc Co Ohio Services Careers Architects Notes Projects
130 Artake Design & Associates Ltd.
Design and
Design and contracting service located in Hong Kong. Services offered, references and contact information are provided.
Design and contracting service located in Hong Kong. Services offered, references and contact information are provided.
131 Mcmusa, Inc.
Full-service general
Full-service general contracting firm offering design, architectural, and construction services. Contains descriptions of services and images of examples.
Services Health Construction Healthcare General Work Practice Full Quality Controls Offering Massachusetts Cambridge Mcm’s Hospital–west Har Conn Stores Firm Login
Full-service general contracting firm offering design, architectural, and construction services. Contains descriptions of services and images of examples.
Services Health Construction Healthcare General Work Practice Full Quality Controls Offering Massachusetts Cambridge Mcm’s Hospital–west Har Conn Stores Firm Login
132 G & C Electric, Inc.
Commercial construction
Commercial construction and service. Offers a variety of services for the commercial community electrical contracting, data and telephone cabling systems.
é›»æ°Ã¢â‚¬â€å·¥äºÃ¢â‚¬Â¹å£«ã®è³Ã¢â‚¬Â¡æ ¼ã¨ä»Ã¢â‚¬Â¢äºÃ¢â‚¬Â¹ é›»æ°Ã¢â‚¬â€å·¥äºÃ¢â‚¬Â¹å£«ã®å…ÂÂ許ã‚’å–å¾Ã¢â‚¬â€ã™るãŸã‚ÂÂã« é›»æ°Ã¢â‚¬â€å·¥
Commercial construction and service. Offers a variety of services for the commercial community electrical contracting, data and telephone cabling systems.
é›»æ°Ã¢â‚¬â€å·¥äºÃ¢â‚¬Â¹å£«ã®è³Ã¢â‚¬Â¡æ ¼ã¨ä»Ã¢â‚¬Â¢äºÃ¢â‚¬Â¹ é›»æ°Ã¢â‚¬â€å·¥äºÃ¢â‚¬Â¹å£«ã®å…ÂÂ許ã‚’å–å¾Ã¢â‚¬â€ã™るãŸã‚ÂÂã« é›»æ°Ã¢â‚¬â€å·¥
133 Bucks County TimberCraft Inc.
Custom design
Custom design contracting firm specializing in adaptive reuse of old barns into unique homes. Features portfolio, FAQs, news. Based in Carversville, PA.
Custom design contracting firm specializing in adaptive reuse of old barns into unique homes. Features portfolio, FAQs, news. Based in Carversville, PA.
134 Densification, Inc.
Geotechnical contracting
Geotechnical contracting and consulting company providing services for improving poor soils or questionable fills prior to construction. Includes brochure in pdf format and a photo gallery.
Densification Inc Dynamic Soil Compaction Geotechnical Projects Advantages Fills Types Geographic Signature Locations Applicable Contractors Materials Karst Atthe
Geotechnical contracting and consulting company providing services for improving poor soils or questionable fills prior to construction. Includes brochure in pdf format and a photo gallery.
Densification Inc Dynamic Soil Compaction Geotechnical Projects Advantages Fills Types Geographic Signature Locations Applicable Contractors Materials Karst Atthe
135 Tradis Displays
Ridgefield Park
Ridgefield Park, New Jersey display house offering custom and modular exhibition design, fabrication, storage, shipping, installation, dismantle, and show contracting.
Displays Show York Trade Florida Tradis Booths New Custom Inc Contact Exhibit Well Offer Exhibits Just World Contracting
Ridgefield Park, New Jersey display house offering custom and modular exhibition design, fabrication, storage, shipping, installation, dismantle, and show contracting.
Displays Show York Trade Florida Tradis Booths New Custom Inc Contact Exhibit Well Offer Exhibits Just World Contracting
136 AudioControl Industrial
Professional audio
Professional audio electronics, for testing and installation contracting applications. Spectrum analyzers, IASYS setup tools, cable testers, multi-zone amps.
Hosting Domain Marketing Network Web Solutions Services Names Website Registration Place Name Grow Innovative Y
Professional audio electronics, for testing and installation contracting applications. Spectrum analyzers, IASYS setup tools, cable testers, multi-zone amps.
Hosting Domain Marketing Network Web Solutions Services Names Website Registration Place Name Grow Innovative Y
137 Tenbusch Contracting Inc.
Install rigid
Install rigid pipe with the tenbusch insertion method (TIM)while eliminating excavation. Applications: sewer, water, industrial drain/supply.
Equipment Tenbusch Underground Inc Field Oil Heavy Well Contact Servicing Directory Services Sites Used
Install rigid pipe with the tenbusch insertion method (TIM)while eliminating excavation. Applications: sewer, water, industrial drain/supply.
Equipment Tenbusch Underground Inc Field Oil Heavy Well Contact Servicing Directory Services Sites Used
138 Pitzer Consulting
Pro/E (Pro/Engineer)
Pro/E (Pro/Engineer) design. Mechanical (FEA) structural, vibration, motion (mechanism) analysis and simulation. contracting and consulting. robots and robotic combat
Pro/E (Pro/Engineer) design. Mechanical (FEA) structural, vibration, motion (mechanism) analysis and simulation. contracting and consulting. robots and robotic combat
139 flexible industrial solutions inc.
electrical controls
electrical controls design and build, project management, plc and robot programming, panel build, wiring, contracting and service.
electrical controls design and build, project management, plc and robot programming, panel build, wiring, contracting and service.
140 Edwin Brady Construction Co., Inc.
Licensed in
Licensed in Kentucky and Colorado as an engineering and specialty contracting firm. Area of expertise is in specialty grouting and concrete repair.
Tunnel Tunnels Rr Mccoy Utility Elkhorn Shotcrete Dam Quarries Bridge Hanson Biltmore Incline Tn Quarry Coal Center Norfolk Mine Services
Licensed in Kentucky and Colorado as an engineering and specialty contracting firm. Area of expertise is in specialty grouting and concrete repair.
Tunnel Tunnels Rr Mccoy Utility Elkhorn Shotcrete Dam Quarries Bridge Hanson Biltmore Incline Tn Quarry Coal Center Norfolk Mine Services
141 Cal Electro Inc.
Electrical contracting
Electrical contracting for industrial installations. Construct substations, transmission line backup generators, distribution systems, and airport lighting systems.
Electrical contracting for industrial installations. Construct substations, transmission line backup generators, distribution systems, and airport lighting systems.
142 K. Earle Forestry Consultants
Offers a
Offers a forestry consulting and contracting service, with assignments varying from the plantation of a small wood to the management of a large Estate.
Offers a forestry consulting and contracting service, with assignments varying from the plantation of a small wood to the management of a large Estate.
143 Project Airconditioning
Contractors engaged
Contractors engaged in commercial, industrial and residential consulting and contracting services in ducted reverse cycle, evaporative, gas central heating, ventilation and air purification systems throughout Australia.
Contractors engaged in commercial, industrial and residential consulting and contracting services in ducted reverse cycle, evaporative, gas central heating, ventilation and air purification systems throughout Australia.
144 quality management systems company
offering world
offering world class manufacturing systems consulting and contracting services, with continued on-site assistance to achieve your iso/qs objectives.
offering world class manufacturing systems consulting and contracting services, with continued on-site assistance to achieve your iso/qs objectives.
145 anderson coach and travel
greenville, pennsylvania
greenville, pennsylvania, operator of charter bus services, sightseeing tours and school bus contracting. includes information on tours, charters, and employment.
Bus Travel Motorcoach Coach Tours Anderson Tour Group Voter Charter Join Trips Gift Certificates Express Reeves Equipment Station
greenville, pennsylvania, operator of charter bus services, sightseeing tours and school bus contracting. includes information on tours, charters, and employment.
Bus Travel Motorcoach Coach Tours Anderson Tour Group Voter Charter Join Trips Gift Certificates Express Reeves Equipment Station
146 Apex Information Management Consultants, Inc.
Information technology
Information technology consulting and contracting services including AS/400 automation and support, web development, system analysis and network administration.
Apex Information Contact Technology Management Consultants Careers Today Competencies Company Training Planning Events News Vance Carpenter
Information technology consulting and contracting services including AS/400 automation and support, web development, system analysis and network administration.
Apex Information Contact Technology Management Consultants Careers Today Competencies Company Training Planning Events News Vance Carpenter
147 Apex Information Management Consultants, Inc.
Information technology
Information technology consulting and contracting services including AS/400 automation and support, web development, system analysis and network administration.
Apex Information Contact Management Consultants Technology News Vance Today Competencies Training Company Careers Planning Stories Infrastructure Contingency
Information technology consulting and contracting services including AS/400 automation and support, web development, system analysis and network administration.
Apex Information Contact Management Consultants Technology News Vance Today Competencies Training Company Careers Planning Stories Infrastructure Contingency
148 Architects Atelier
Architects, engineers
Architects, engineers and valuers performing traditional practice plus space planning, interior design, contracting, development, and civil engineering services.
Architects, engineers and valuers performing traditional practice plus space planning, interior design, contracting, development, and civil engineering services.
149 The Turner Corporation
Provides general
Provides general contracting, construction management and program management services for professional sports stadiums and arenas. Includes links to representative projects.
Provides general contracting, construction management and program management services for professional sports stadiums and arenas. Includes links to representative projects.
150 S. McNally & Sons
Contracting firm
Contracting firm based in Hamilton, Ontario, Canada offering large diameter tunneling, microtunneling, pipe jacking, and utility tunneling.
Marine Company Quality Health Projects Safety Environmental Mcnally International Inc Tunnelling Releases Press Transportation Wharfs Environment Systems
Contracting firm based in Hamilton, Ontario, Canada offering large diameter tunneling, microtunneling, pipe jacking, and utility tunneling.
Marine Company Quality Health Projects Safety Environmental Mcnally International Inc Tunnelling Releases Press Transportation Wharfs Environment Systems
151 TSN Ltd.
Electrical contractor
Electrical contractor based in Russia. Design and build electrical boards and switchgear. General electrical contracting.
Electrical contractor based in Russia. Design and build electrical boards and switchgear. General electrical contracting.
152 Stay Kleen Services & Contracting Ltd.
Expertise includes
Expertise includes qualified trades people and staff to assess, estimate, and restore all types of losses including: fire, water, wind and smoke damage.
Expertise includes qualified trades people and staff to assess, estimate, and restore all types of losses including: fire, water, wind and smoke damage.
153 hongkong electric holdings
generates and
generates and supplies electricity, online account access, news and other information. other activities include consulting, contracting, advertising, financing and investment holding. (nasdaq:hgkgy).
Httpwwwhkelectriccomsystem Hec Busy Request Z
generates and supplies electricity, online account access, news and other information. other activities include consulting, contracting, advertising, financing and investment holding. (nasdaq:hgkgy).
Httpwwwhkelectriccomsystem Hec Busy Request Z
154 Defense Industry Daily
News briefing
News briefing for defense procurement and defense contracting executives.
Defense Missile Support Other Air Weapons Equipment Program News Industry Military Space Advertising Systems Reports Long Range Kdx Iii Subscriptionin Depth Fighter Paid Versatile
News briefing for defense procurement and defense contracting executives.
Defense Missile Support Other Air Weapons Equipment Program News Industry Military Space Advertising Systems Reports Long Range Kdx Iii Subscriptionin Depth Fighter Paid Versatile
155 Brivar Construction Company
Design/build, construction
Design/build, construction management, and general contracting services for commercial, industrial, and institutional projects located in South-East Michigan.
Construction Brivar Michigan Company South Contracting East Institutional Industrial Designbuild Commercial Services Projects General Delivers
Design/build, construction management, and general contracting services for commercial, industrial, and institutional projects located in South-East Michigan.
Construction Brivar Michigan Company South Contracting East Institutional Industrial Designbuild Commercial Services Projects General Delivers
156 Krill Construction
Company based
Company based in Cleveland, and providing services including commercial and residential design-build, historic restoration, construction management, and general contracting.
Company based in Cleveland, and providing services including commercial and residential design-build, historic restoration, construction management, and general contracting.
157 Mortenson Construction
Construction services
Construction services include planning, development, preconstruction, general contracting, management, design and build, engineer,procure and construct, maintenance and operations.
Construction Mortenson Services Development Energy Canada Sustainable Design China Location Denver Illinois Career Project Colorado Build Office Known Solutions Center
Construction services include planning, development, preconstruction, general contracting, management, design and build, engineer,procure and construct, maintenance and operations.
Construction Mortenson Services Development Energy Canada Sustainable Design China Location Denver Illinois Career Project Colorado Build Office Known Solutions Center
158 Cygnet Pro Staffing, Inc.
Pairs independent
Pairs independent contracting speech, occupational, and physical therapists, as well as school psychologists to educational and early intervention agencies, including school districts.
Here Information Posted Concrete Hair Party Sydney Catering Bachelorette Trading Thermometer Laser Solar Pointer Life Didonatosrefers Public
Pairs independent contracting speech, occupational, and physical therapists, as well as school psychologists to educational and early intervention agencies, including school districts.
Here Information Posted Concrete Hair Party Sydney Catering Bachelorette Trading Thermometer Laser Solar Pointer Life Didonatosrefers Public
159 DCD Insurance Services
A multi-line
A multi-line independent insurance brokerage, for agriculture, food processing, property management, wholesale distributors, retail, service, contracting, and trucking.
Insurance Business Dcd Life Agency Santa Services True Full Personal Policy Privacy Offering Y
A multi-line independent insurance brokerage, for agriculture, food processing, property management, wholesale distributors, retail, service, contracting, and trucking.
Insurance Business Dcd Life Agency Santa Services True Full Personal Policy Privacy Offering Y
160 Omzest Group: Omar Zawawi Establishment
Conglomerate includes
Conglomerate includes construction and contracting, manufacturing, services, trading and agency representation, and training and education. Over 70 wholly owned and associate companies, with headquarters in Muscat.
Oman Services Omzest Investments Hsbc Opportunities Empowering Construction Training Financial Trading Education News Leveraging Manufacturing Ibra Mission
Conglomerate includes construction and contracting, manufacturing, services, trading and agency representation, and training and education. Over 70 wholly owned and associate companies, with headquarters in Muscat.
Oman Services Omzest Investments Hsbc Opportunities Empowering Construction Training Financial Trading Education News Leveraging Manufacturing Ibra Mission
161 firestopping - the ajr companies
providing turnkey
providing turnkey facilities engineering and field contracting solutions to health care, industrial, commercial and educational facilities. based in the chicagoland area, we serve the midwest.
Domain Ajrcompaniescom Parking Programm Ajrcompanies Informationen Thema Inhaber Infohtmlcategory=keyword=token= Beacons Beacon Denicdeby Interessante Here Erfolgreich Whois
providing turnkey facilities engineering and field contracting solutions to health care, industrial, commercial and educational facilities. based in the chicagoland area, we serve the midwest.
Domain Ajrcompaniescom Parking Programm Ajrcompanies Informationen Thema Inhaber Infohtmlcategory=keyword=token= Beacons Beacon Denicdeby Interessante Here Erfolgreich Whois
162 bouygues offshore
business segments
business segments include oil and gas contracting, maintenance services, maritime and river works, liquefied gases, chemicals, refining and energy. offers financial information, news, details on new concepts and solutions.
Notre Saipem France Management Installation Achats Procédés Mobilité Approvisionnements Fabrication Sécurité Projets Carrière Gestion Etudes Expatriation Pour Contrats
business segments include oil and gas contracting, maintenance services, maritime and river works, liquefied gases, chemicals, refining and energy. offers financial information, news, details on new concepts and solutions.
Notre Saipem France Management Installation Achats Procédés Mobilité Approvisionnements Fabrication Sécurité Projets Carrière Gestion Etudes Expatriation Pour Contrats
163 AMS Mechanical Services, Inc.
Full-service mechanical
Full-service mechanical contracting. Includes services and contacts. Locations in Illinois and Northeast Indiana.
Ams Mechanical Full Hvac Piping Industrial Electrical Contracting Systems Safety Inc Maintenance Link Quality Refrigeration Contact Complete
Full-service mechanical contracting. Includes services and contacts. Locations in Illinois and Northeast Indiana.
Ams Mechanical Full Hvac Piping Industrial Electrical Contracting Systems Safety Inc Maintenance Link Quality Refrigeration Contact Complete
164 AMS Mechanical Services, Inc.
Full-service mechanical
Full-service mechanical contracting. Includes services and contacts. Locations in Illinois and Northeast Indiana.
Full-service mechanical contracting. Includes services and contacts. Locations in Illinois and Northeast Indiana.
165 Clement And Sons Dirt Contracting
Clement and
Clement and Sons offers services that are supported by 42 years of knowledge, skills and experience.
Clement and Sons offers services that are supported by 42 years of knowledge, skills and experience.
166 Apparel Marketing Group
USA. Business
USA. Business consultants to the apparel and fashion industries, specializing in marketing and sales representatives recruitment and contracting.
USA. Business consultants to the apparel and fashion industries, specializing in marketing and sales representatives recruitment and contracting.
167 Precision Development Cast Stone
Specializing in
Specializing in Cast Stone and custom brick/stucco contracting in the greater Houston area.
Fireplace Mantel Mantels Marble Wood Mantle Brick Cast Surround Antique Stone Decorating Custom Fireplaces Design
Specializing in Cast Stone and custom brick/stucco contracting in the greater Houston area.
Fireplace Mantel Mantels Marble Wood Mantle Brick Cast Surround Antique Stone Decorating Custom Fireplaces Design
168 Sabre Exploration Services
Custom claim
Custom claim staking and line cutting. Mineral exploration services and contracting.
Custom claim staking and line cutting. Mineral exploration services and contracting.
169 acute environmental services inc.
provides environmental
provides environmental and site remediation contracting as well as a variety of industrial health and safety services.
provides environmental and site remediation contracting as well as a variety of industrial health and safety services.
170 Government Executive Magazine
GovExec is
GovExec is an online magazine which provides subscribers with information of timely interest to contracting professionals working in the government marketplace.
GovExec is an online magazine which provides subscribers with information of timely interest to contracting professionals working in the government marketplace.
171 Kleinknecht Electric Corporation
Electrical maintenance
Electrical maintenance contracting firm in NY and NJ.Offers a full range of electrical, data, telecommunications and maintenance services.
Electrical maintenance contracting firm in NY and NJ.Offers a full range of electrical, data, telecommunications and maintenance services.
172 Cohen International
Provides business
Provides business development, especially with Japanese firms,business plan development, market research,government contracting and technical writing.
Provides business development, especially with Japanese firms,business plan development, market research,government contracting and technical writing.
173 Valerie Frederickson and Company
Offers human
Offers human resources services including retained executive search, compliance/audits and contracting, succession planning, management development, executive coaching and outplacement.
Offers human resources services including retained executive search, compliance/audits and contracting, succession planning, management development, executive coaching and outplacement.
174 Hairel Enterprises
Comprehensive integrated
Comprehensive integrated systems contracting company. Sound reinforcement, architectural and theatrical lighting and control, video projection, and communications systems design, installation and training services.
Theaters Churches Demo Motion Video Pictures Sound News Stack Projects Light Meet Download He Worship Slideshow Javascript
Comprehensive integrated systems contracting company. Sound reinforcement, architectural and theatrical lighting and control, video projection, and communications systems design, installation and training services.
Theaters Churches Demo Motion Video Pictures Sound News Stack Projects Light Meet Download He Worship Slideshow Javascript
175 stitch by stitch
usa. provides
usa. provides private label contracting on bags and totes, pillow, filters and apparel. includes a company profile, a project form, faqs and employment opportunities. located in brainerd, minnesota.
usa. provides private label contracting on bags and totes, pillow, filters and apparel. includes a company profile, a project form, faqs and employment opportunities. located in brainerd, minnesota.
176 Valerie Frederickson and Company
Offers human
Offers human resources services including retained executive search, HR compliance/audits, HR contracting, succession planning, management development, executive coaching and outplacement.
Hr Consulting Executive Outplacement Contracting Valerie Atlanta Frederickson Hear Clients Learn Francisco San Silicon Valley
Offers human resources services including retained executive search, HR compliance/audits, HR contracting, succession planning, management development, executive coaching and outplacement.
Hr Consulting Executive Outplacement Contracting Valerie Atlanta Frederickson Hear Clients Learn Francisco San Silicon Valley
177 Creative Modular Buildings, Inc.
A commercial
A commercial contracting company providing permanent and portable modular buildings.
A commercial contracting company providing permanent and portable modular buildings.
178 S & Techs, Hong Kong Ltd.
A general
A general contracting firm with local expertise providing construction management and consulting services in Hong Kong and China.
Stechs Engineering – Pavarini Grosvenor Apr York Statement Awarded Cons Mission Careers Updates New Organization æ¦æ¼¢å¤河汽 å¯Ã…’士é›»æ©Ã…¸ï¼Ã‹â€ Japanese English サイトマãÆ’Æ’ãÆ’â€â€
A general contracting firm with local expertise providing construction management and consulting services in Hong Kong and China.
Stechs Engineering – Pavarini Grosvenor Apr York Statement Awarded Cons Mission Careers Updates New Organization æ¦æ¼¢å¤河汽 å¯Ã…’士é›»æ©Ã…¸ï¼Ã‹â€ Japanese English サイトマãÆ’Æ’ãÆ’â€â€
179 Sancon Engineering Inc.
Sancon Engineering
Sancon Engineering, a contracting firm based in Huntington Beach, California, specializes in the rehabilitation of sanitary sewer pipelines and structures.
Sancon Engineering Inc Rehabilitation Services Design Contact Fiber Website Directions Request Aluminate Arrowlock Engineer Link Allrights
Sancon Engineering, a contracting firm based in Huntington Beach, California, specializes in the rehabilitation of sanitary sewer pipelines and structures.
Sancon Engineering Inc Rehabilitation Services Design Contact Fiber Website Directions Request Aluminate Arrowlock Engineer Link Allrights
180 SmartMed
A medical
A medical billing company offering: electronic claim submission, patient billing, medical collection, insurance follow-up, contracting and credentialing.
A medical billing company offering: electronic claim submission, patient billing, medical collection, insurance follow-up, contracting and credentialing.
181 National Communications Contracting
Alliance of
Alliance of communication installation and service companies. Services include satellite data, local area networks, RF distribution design and system head end construction termination. Includes list of members.
Alliance of communication installation and service companies. Services include satellite data, local area networks, RF distribution design and system head end construction termination. Includes list of members.
182 mountain air helicopters
fire fighting
fire fighting, sling, charter, seeding, photography, concrete pouring, wildlife services, seismic exploration, avalanche control, government contracting, bale bombing, power line patrol, new mexico
fire fighting, sling, charter, seeding, photography, concrete pouring, wildlife services, seismic exploration, avalanche control, government contracting, bale bombing, power line patrol, new mexico
183 Technixs Network Services
A neutral
A neutral voice vendor, data, and video communications consulting and contracting company with expertise in broadband carrier, PBX, LAN/WAN, engineering, proposal preparation, project management, local government networks and training.
Systems Technixs Network Services Right Way Engineering Wireless Operations Plant Microwave Welcome Test Generators Outside Lan Explore
A neutral voice vendor, data, and video communications consulting and contracting company with expertise in broadband carrier, PBX, LAN/WAN, engineering, proposal preparation, project management, local government networks and training.
Systems Technixs Network Services Right Way Engineering Wireless Operations Plant Microwave Welcome Test Generators Outside Lan Explore
184 pacific energy strategies, llc
hawaii based
hawaii based energy service company (esco) providing energy surveying, engineering, general contracting services,and financing / equipment leasing arrangements.
hawaii based energy service company (esco) providing energy surveying, engineering, general contracting services,and financing / equipment leasing arrangements.
185 mgm engineering and contracting
engineering company
engineering company established in milan in 2003, exploiting the value and long term experience of a group of managers and technicians coming from recognized companies of the engineering and energy industry.
Di Plants Impianti Ingegneria Energy Engineering Skid Energia Design Power Centrali Cogenerazione Servizi Mgmc Turbine Studies
engineering company established in milan in 2003, exploiting the value and long term experience of a group of managers and technicians coming from recognized companies of the engineering and energy industry.
Di Plants Impianti Ingegneria Energy Engineering Skid Energia Design Power Centrali Cogenerazione Servizi Mgmc Turbine Studies
186 DM Robichaud Associates
DM Robichaud
DM Robichaud Associates is a contracting firm in Ontario, Canada which relines sewers and laterals, chemically seals manholes and reduces sewer flows.
Sewer Lining Trunk Culvert Cleaning Trenchless Rehabilitation Contact Inspection Repairs Sealing Specialists Form Cure Cutting
DM Robichaud Associates is a contracting firm in Ontario, Canada which relines sewers and laterals, chemically seals manholes and reduces sewer flows.
Sewer Lining Trunk Culvert Cleaning Trenchless Rehabilitation Contact Inspection Repairs Sealing Specialists Form Cure Cutting
187 C&H Agency
Insurance agency
Insurance agency provides construction, surety, bonds, commercial, contracting, building and manufacturing insurance, risk management, and financial services to New Jersey businesses.
[+] News Services Surety Contact Read Administration Directions Agency Inc Insurance → Claims Bond Copyright $
Insurance agency provides construction, surety, bonds, commercial, contracting, building and manufacturing insurance, risk management, and financial services to New Jersey businesses.
[+] News Services Surety Contact Read Administration Directions Agency Inc Insurance → Claims Bond Copyright $
188 Herby Enterprises Limited
Herby Enterprises
Herby Enterprises, a northern Ontario, Canada based contracting firm, supplies complete Sewer Line Trenchless Technologies.
Herby Enterprises, a northern Ontario, Canada based contracting firm, supplies complete Sewer Line Trenchless Technologies.
189 C&H Agency
Insurance agency
Insurance agency provides construction, surety, bonds, commercial, contracting, building and manufacturing insurance, risk management, and financial services to New Jersey businesses.
Insurance agency provides construction, surety, bonds, commercial, contracting, building and manufacturing insurance, risk management, and financial services to New Jersey businesses.
190 Swinerton Builders
Offer general
Offer general contracting, construction management, engineering, industrial and specialty construction, property management, and consulting services throughout the United States.
Swinerton Area Collabcenter Markets Internal Deep Mid Market Locations Services Tomorrow Growth Projects Builds Francisco Capitalize Jobsite Envisioning
Offer general contracting, construction management, engineering, industrial and specialty construction, property management, and consulting services throughout the United States.
Swinerton Area Collabcenter Markets Internal Deep Mid Market Locations Services Tomorrow Growth Projects Builds Francisco Capitalize Jobsite Envisioning
191 Technical Electrical Consulting and Training
TECT, Inc.
TECT, Inc. offers on-site linemans training, consulting services, audits, and contracting specializing in live line maintenance.
TECT, Inc. offers on-site linemans training, consulting services, audits, and contracting specializing in live line maintenance.
192 north country environmental services
fully insured
fully insured environmental contracting company serves industrial, commercial, institutional, and government providing clean-up services.
fully insured environmental contracting company serves industrial, commercial, institutional, and government providing clean-up services.
193 Bay State Piping Company, Inc.
Massachusetts based
Massachusetts based contracting firm with experience in directional drilling, downhole rock drilling, pipe ramming, horizontal auger boring, steerable rod pushing, and percussion moling.
State Piping Company Contact Inc Welcome Bay Statement Privacy Auger Construction Boring Options Friday Drilling Street Horizontal Trenchless
Massachusetts based contracting firm with experience in directional drilling, downhole rock drilling, pipe ramming, horizontal auger boring, steerable rod pushing, and percussion moling.
State Piping Company Contact Inc Welcome Bay Statement Privacy Auger Construction Boring Options Friday Drilling Street Horizontal Trenchless
194 Structural Insulated Panel
Firm designing
Firm designing and engineering and installing structural insulated panels since 1981 offering on-site technical and full general contracting services.
Sips Systems Shell Building Design Report Technical Questions Information Benefits Frequent Team Code Contact Gallery Value Green Alps Developers
Firm designing and engineering and installing structural insulated panels since 1981 offering on-site technical and full general contracting services.
Sips Systems Shell Building Design Report Technical Questions Information Benefits Frequent Team Code Contact Gallery Value Green Alps Developers
195 Basin Construction
Site excavating
Site excavating and grading contracting services for Southern California. An overview of capabilities, services and past projects are provided. Based in Chino, California.
Construction Basin Co Inc Media Grading Rights California Reserved Excavating Text Webmaster Industrial Contact Buildings Images Upbuildings
Site excavating and grading contracting services for Southern California. An overview of capabilities, services and past projects are provided. Based in Chino, California.
Construction Basin Co Inc Media Grading Rights California Reserved Excavating Text Webmaster Industrial Contact Buildings Images Upbuildings
196 Amerisure Mutual Insurance Company
Provides insurance
Provides insurance for workers compensation, contractor and manufacturer programs, commercial property, and coverage enhancements for manufacturing, contracting, and commercial enterprises.
Provides insurance for workers compensation, contractor and manufacturer programs, commercial property, and coverage enhancements for manufacturing, contracting, and commercial enterprises.
197 Rammed Earth Development
Designs and
Designs and builds rammed earth and adobe houses. Includes information about the design and process, general contracting, and wall ramming services.
Designs and builds rammed earth and adobe houses. Includes information about the design and process, general contracting, and wall ramming services.
198 Unionmatex GmbH
Germany. Engineering
Germany. Engineering and general contracting company specialised in plant installations for the textile and apparel, leather, food products, wood processing, cellulose extraction, and recycling and environmental technologies. Multi-lingual site.
Unionmatex Industrieanlagen Unternehmen Textilfabriken Sachsen Textilmaschinen Projekte Frankfurt Umwelttechnik News Leistungen Büro Geschäftsfelder Chemnitz Mönchengladbach Nahrungsgüter Firma Projektierungsunternehmen
Germany. Engineering and general contracting company specialised in plant installations for the textile and apparel, leather, food products, wood processing, cellulose extraction, and recycling and environmental technologies. Multi-lingual site.
Unionmatex Industrieanlagen Unternehmen Textilfabriken Sachsen Textilmaschinen Projekte Frankfurt Umwelttechnik News Leistungen Büro Geschäftsfelder Chemnitz Mönchengladbach Nahrungsgüter Firma Projektierungsunternehmen
199 Farm Files
A farm
A farm software package that tracks farm crop information, expenses, and income, field mapping, harvest data, planting, tillage, chemicals, fertilizer, forward contracting.
A farm software package that tracks farm crop information, expenses, and income, field mapping, harvest data, planting, tillage, chemicals, fertilizer, forward contracting.
200 Advance Boring Specialists
Washington and
Washington and California based contracting firm specializing in the trenchless installation of Phone, Fiber Optics, Gas, Electrical, and Water lines through horizintal directional boring. ABS also provides sewer rehabilitation services.
Washington and California based contracting firm specializing in the trenchless installation of Phone, Fiber Optics, Gas, Electrical, and Water lines through horizintal directional boring. ABS also provides sewer rehabilitation services.
2. Shopping and Contracting Trade
1 Midwest Contracting
Home of
Home of the Dirt King Trike.
Mcm Manufacturing Inc Websitefound Metals Company Kingproducts Dirt Usa Found The Contact
Home of the Dirt King Trike.
Mcm Manufacturing Inc Websitefound Metals Company Kingproducts Dirt Usa Found The Contact
2 Peak Pure Air Mechanical Contracting, Inc.
Offers air
Offers air purifiers using multiple technologies including HEPA, Ions, and electrostatic.
Air Oasis Purifiers Ozone Purifier Hepa Cleaner Photocatalytic Mold Uv Ionic Tio Cleaners Works Commercial Intelli Pro
Offers air purifiers using multiple technologies including HEPA, Ions, and electrostatic.
Air Oasis Purifiers Ozone Purifier Hepa Cleaner Photocatalytic Mold Uv Ionic Tio Cleaners Works Commercial Intelli Pro
3 Accessible Environments
Offers a
Offers a wide range of products for home accessibility. Nationwide bathroom and kitchen construction contracting.
Shower Grab Accessible Lifts Shipping Bars Free Showers Wheelchair Cart Water Continental Ada Walk Seachrome Ez Access Within Wall
Offers a wide range of products for home accessibility. Nationwide bathroom and kitchen construction contracting.
Shower Grab Accessible Lifts Shipping Bars Free Showers Wheelchair Cart Water Continental Ada Walk Seachrome Ez Access Within Wall
4 The Automatic Group Tennis Corp.
Contracting group
Contracting group that does tennis court construction, design and development, and general landscaping.
Found Theserver Port Foundapache
Contracting group that does tennis court construction, design and development, and general landscaping.
Found Theserver Port Foundapache
5 Sharp Electrical Services
Sales and
Sales and services emergency power systems. Also offers complete electrical contracting and consulting services.
Z Sharpelectricalcom Y
Sales and services emergency power systems. Also offers complete electrical contracting and consulting services.
Z Sharpelectricalcom Y
6 DAdairs Cosmetics, Inc.
Formula of
Formula of herbs, vital minerals, essential oils for removing wrinkles, tightening skin, astringing large pores, checking the overactivity of the sebaceous glands, contracting the enlarged capillaries, and maintaining a healthy skin.
Engine Pleasecouldnt Contact Domain Looking Wordpresssorry Hosting Nothingfinely Wordpress Throughmywpenginecom Youre
Formula of herbs, vital minerals, essential oils for removing wrinkles, tightening skin, astringing large pores, checking the overactivity of the sebaceous glands, contracting the enlarged capillaries, and maintaining a healthy skin.
Engine Pleasecouldnt Contact Domain Looking Wordpresssorry Hosting Nothingfinely Wordpress Throughmywpenginecom Youre
3. Contracting Recreation
1 Watkins Contracting, Inc.
San Diego
San Diego based construction management and environmental clean-up contractor.
Contracting Watkins Inc Copyrightincwatkinsrightsreserved Inc‚ÉÃ…Â Ö‚·Ã¢â‚¬Å¡éÂÂî•ñ Inc‚»Ã¢â‚¬Å¡Ì‘¼Ã… ÖËœaÂÂî•ñ
San Diego based construction management and environmental clean-up contractor.
Contracting Watkins Inc Copyrightincwatkinsrightsreserved Inc‚ÉÃ…Â Ö‚·Ã¢â‚¬Å¡éÂÂî•ñ Inc‚»Ã¢â‚¬Å¡Ì‘¼Ã… ÖËœaÂÂî•ñ
2 Cooper Radiology Contracting, Inc
Radiologist offering
Radiologist offering USA nationwide services as an independent contractor to help healthcare facilities with short term staffing shortages in diagnostic radiology.
Navigationshilfe Ty
Radiologist offering USA nationwide services as an independent contractor to help healthcare facilities with short term staffing shortages in diagnostic radiology.
Navigationshilfe Ty
3 Midwest Emergency Department Services
An Emergency
An Emergency Department contracting firm providing emergency health care providers to emergency rooms around the nation. Located in OFallon, Illinois.
Hospital Meds Emergency Care Solutions Community News Departments Physicians Services Josephs Immediate Elizabeths Department Media Ottawa
An Emergency Department contracting firm providing emergency health care providers to emergency rooms around the nation. Located in OFallon, Illinois.
Hospital Meds Emergency Care Solutions Community News Departments Physicians Services Josephs Immediate Elizabeths Department Media Ottawa
4 AQ Management & Control, Inc.
A full
A full service environmental contracting and consulting firm. Specializes in asbestos removal, lead abatement, hazardous materials removal, soil remediation, industrial cleaning, fire and water damage restoration, mold cleanup, microbiology decontamination, Anthrax biohazard and related services.
Mold Cleanup Rental Damage Removal Water Asbestos Air Restoration Equipment Abatement Carpet Lead Testing Dehumidifier De
A full service environmental contracting and consulting firm. Specializes in asbestos removal, lead abatement, hazardous materials removal, soil remediation, industrial cleaning, fire and water damage restoration, mold cleanup, microbiology decontamination, Anthrax biohazard and related services.
Mold Cleanup Rental Damage Removal Water Asbestos Air Restoration Equipment Abatement Carpet Lead Testing Dehumidifier De
5 Saint Francis Care
Connecticut physician
Connecticut physician hospital organization that facilitates managed care contracting relationships for Saint Francis Hospital and Medical Center and its affiliated doctors.
Health Care Francis Saint Surgery Medicine Center Medical Ct Education Discusses Fox Hospital Dr Physician Nbc
Connecticut physician hospital organization that facilitates managed care contracting relationships for Saint Francis Hospital and Medical Center and its affiliated doctors.
Health Care Francis Saint Surgery Medicine Center Medical Ct Education Discusses Fox Hospital Dr Physician Nbc
4. Computer & Contracting Games Websites
1 The Igneous Group
Specializing in
Specializing in ColdFusion contracting and dynamic web sites for businesses.
Business Technology Igneous Group Consulting Success Strategic Leaders Needs Consultants Caras Strategy Contact Align Portfolio Wecan Rocksolid
Specializing in ColdFusion contracting and dynamic web sites for businesses.
Business Technology Igneous Group Consulting Success Strategic Leaders Needs Consultants Caras Strategy Contact Align Portfolio Wecan Rocksolid
2 Jacques, Beatrice
Online resume
Online resume and portfolio for a contracting PHP and general website programer.
Development Jscript Resume Softwarez
Online resume and portfolio for a contracting PHP and general website programer.
Development Jscript Resume Softwarez
3 Azisa
Specializing in
Specializing in network design, deployment and operation. Also provide software contracting services.
Page Secure Login Documentz
Specializing in network design, deployment and operation. Also provide software contracting services.
Page Secure Login Documentz
4 Pennington Technical Arts
Software systems
Software systems, internet contracting, programming and database with web design.
Pennington Arts Antonio Systems Mysql Visual Javascript Nasa Midi Research Server Southwest Skills Cics Html Labs Development Database Application
Software systems, internet contracting, programming and database with web design.
Pennington Arts Antonio Systems Mysql Visual Javascript Nasa Midi Research Server Southwest Skills Cics Html Labs Development Database Application
5 Nenadov, Mark
Brainbench certified
Brainbench certified freelance PHP developer, offers sub-contracting and development services.
Wildlife Genealogy Newton List Software Calvinist Life Things Prose Work John Review Baptist Brown Cardinal Poets Expounded Resume
Brainbench certified freelance PHP developer, offers sub-contracting and development services.
Wildlife Genealogy Newton List Software Calvinist Life Things Prose Work John Review Baptist Brown Cardinal Poets Expounded Resume
6 Aesiq, Inc.
Develops EJB
Develops EJB, JSP and servlet solutions as well as full applications for the desktop or server. Consulting and contracting.
Azure Sites Microsoft Click Error Found The Azure’s Ipaddress Cnameifthis Address Withmicrosoft Portal Internetservice
Develops EJB, JSP and servlet solutions as well as full applications for the desktop or server. Consulting and contracting.
Azure Sites Microsoft Click Error Found The Azure’s Ipaddress Cnameifthis Address Withmicrosoft Portal Internetservice
7 Robotech
Provides robotic
Provides robotic solutions in the areas of automotive sealing systems, as well as providing rotators and electrical contracting.
Z Y
Provides robotic solutions in the areas of automotive sealing systems, as well as providing rotators and electrical contracting.
Z Y
8 Robotech
Provides robotic
Provides robotic solutions in the areas of automotive sealing systems, as well as providing rotators and electrical contracting.
Z Robotech Y
Provides robotic solutions in the areas of automotive sealing systems, as well as providing rotators and electrical contracting.
Z Robotech Y
9 Pronto Software
Modules for
Modules for Accounting, Distribution, Manufacturing, Service, Contracting, Point of Sale and other industry applications.
Ftpquotabin Cgi Imgcomponents
Modules for Accounting, Distribution, Manufacturing, Service, Contracting, Point of Sale and other industry applications.
Ftpquotabin Cgi Imgcomponents
10 MOSKAL electric ltd.
Network cabling
Network cabling solutions and Commercial electrical contracting in and around the Winnipeg Manitoba Canada area.
Cabling Network Cable Moskal Winnipeg News Events Manitoba Projects Electrical Computer Contact Testimonials Installations Installers Do Services Photo
Network cabling solutions and Commercial electrical contracting in and around the Winnipeg Manitoba Canada area.
Cabling Network Cable Moskal Winnipeg News Events Manitoba Projects Electrical Computer Contact Testimonials Installations Installers Do Services Photo
11 Symmetry Innovations
Provides extensive
Provides extensive services to the QNX community, from training and consulting, to custom development and contracting. Also distributes QNX and related products.
Goanna Rtos Embedded Development Innovations Risk Assessment Cc++ Products Services Research Tools Cypherbridge Quality Koenig Tool Phone Consulting Streetmitchell
Provides extensive services to the QNX community, from training and consulting, to custom development and contracting. Also distributes QNX and related products.
Goanna Rtos Embedded Development Innovations Risk Assessment Cc++ Products Services Research Tools Cypherbridge Quality Koenig Tool Phone Consulting Streetmitchell
12 Zveno Pty Ltd
An Australian
An Australian company providing XML consulting, contracting and training. Experience with XML system design, XSL stylesheeting and all XML related technologies and products.
Z Y
An Australian company providing XML consulting, contracting and training. Experience with XML system design, XSL stylesheeting and all XML related technologies and products.
Z Y
13 Saunders Contracting Services
Full service
Full service communications installer to include voice, data, and fiber optic systems. Also a state licensed electrical contractor.
Electrical Contractor Services Industrial Telecommunicationshomeserviceshistorycontact Virgina Electric Contracting Hampton Historyincelectrical Commercial Saunders Va
Full service communications installer to include voice, data, and fiber optic systems. Also a state licensed electrical contractor.
Electrical Contractor Services Industrial Telecommunicationshomeserviceshistorycontact Virgina Electric Contracting Hampton Historyincelectrical Commercial Saunders Va
14 Millennium Technical Contracting, Inc.
Recruiters and
Recruiters and job placement of CAD/GIS and engineering jobs for technical personnel on assignment to companies for projects in the US.
Mobile Leave Continue Rarr Reading Engineer Engineers Kinc Great Future Samsung Fingerprint Rules Developers Apps Today Traits
Recruiters and job placement of CAD/GIS and engineering jobs for technical personnel on assignment to companies for projects in the US.
Mobile Leave Continue Rarr Reading Engineer Engineers Kinc Great Future Samsung Fingerprint Rules Developers Apps Today Traits
15 Paradigm Pioneers Inc.
Web hosting
Web hosting, consulting and e-contracting company, professional web development, desktop support, server support.
Click Pioneers Paradigm Help Solutions School News Support Inc Here Database Ppihx Contact Partners Mail Goto Paradigms Access
Web hosting, consulting and e-contracting company, professional web development, desktop support, server support.
Click Pioneers Paradigm Help Solutions School News Support Inc Here Database Ppihx Contact Partners Mail Goto Paradigms Access
16 CUC Software
Offers software
Offers software tailored to the construction and contracting industry. Features screenshots, demonstration and contact information.
Software Reviews Contractor Resources Contact Company Essentials Hvac Webgrain Support Cuc Inc Website Field Costing
Offers software tailored to the construction and contracting industry. Features screenshots, demonstration and contact information.
Software Reviews Contractor Resources Contact Company Essentials Hvac Webgrain Support Cuc Inc Website Field Costing
17 CodeFX Software
Specializes in
Specializes in embedded CIFS and SMB code for consumer electronic devices. Also offers software contracting services.
Codefx Cifs Embedded Smb Software Solutions Here Welcome Diego Click Javadevelopment Version News_ Email Y
Specializes in embedded CIFS and SMB code for consumer electronic devices. Also offers software contracting services.
Codefx Cifs Embedded Smb Software Solutions Here Welcome Diego Click Javadevelopment Version News_ Email Y
18 eBid Systems
BidServer, enables
BidServer, enables paperless purchasing and contracting. Government agencies, contractors, engineers, and manufacturers can achieve dramatic savings with an internet procurement system.
Management Supplier Contract Sourcing Procurement Software Demo Ebid Exchange Contact News Blog Learn Schedule Clients
BidServer, enables paperless purchasing and contracting. Government agencies, contractors, engineers, and manufacturers can achieve dramatic savings with an internet procurement system.
Management Supplier Contract Sourcing Procurement Software Demo Ebid Exchange Contact News Blog Learn Schedule Clients
19 WinSearch
Provides applicant
Provides applicant tracking, resume management and complete contact management for the permanent placement, contracting, and temporary staffing industries. Available in client server, web and ASP versions.
Winsearch Recruiting Learn Software Technical Support Staffing Database Systems Relational Placement Tracking Permanent Training Cloud Test
Provides applicant tracking, resume management and complete contact management for the permanent placement, contracting, and temporary staffing industries. Available in client server, web and ASP versions.
Winsearch Recruiting Learn Software Technical Support Staffing Database Systems Relational Placement Tracking Permanent Training Cloud Test
20 Orases Consulting Corporation
Offers design
Offers design, hosting, e-commerce solutions and database management. Listing of service and support options, case studies, government contracting details and company profile.
Orases Company Blog Awards Meet Capabilities Portfolio Stay Team Help Connected Amazing Policy Comes Agency Linkedin
Offers design, hosting, e-commerce solutions and database management. Listing of service and support options, case studies, government contracting details and company profile.
Orases Company Blog Awards Meet Capabilities Portfolio Stay Team Help Connected Amazing Policy Comes Agency Linkedin
21 Foundation Systems, Inc.
IT consulting
IT consulting and contracting services firm that provides full lifecycle development for new systems and application support for existing systems.
Services Development Staffing Application Consulting Technologies Project Solutions Data Outsourcing Warehousing Company Cybersystems Enterprise Business Retail Program Employment Rssscroller Copyright
IT consulting and contracting services firm that provides full lifecycle development for new systems and application support for existing systems.
Services Development Staffing Application Consulting Technologies Project Solutions Data Outsourcing Warehousing Company Cybersystems Enterprise Business Retail Program Employment Rssscroller Copyright
22 Usability Architects, Inc.
A usability
A usability consulting and contracting firm specializing in designing the user experience with user-centered methodologies.
Usability Design User Testing Analysis Interaction Human Ui Interface Development Courses Evaluation Engineering Heuristic Centered Assessments Customer Computer Interviews
A usability consulting and contracting firm specializing in designing the user experience with user-centered methodologies.
Usability Design User Testing Analysis Interaction Human Ui Interface Development Courses Evaluation Engineering Heuristic Centered Assessments Customer Computer Interviews
23 Embedded Spaces Corporation
Provides consulting
Provides consulting and contracting services in embedded systems, operating systems and product development.
Datasheet Spaces User Powerone Embedded Power Application Control Ii Meter Inc Controller Obd Ambient Quickstart Notices Leds Protect
Provides consulting and contracting services in embedded systems, operating systems and product development.
Datasheet Spaces User Powerone Embedded Power Application Control Ii Meter Inc Controller Obd Ambient Quickstart Notices Leds Protect
24 Umbrella Asset Management Program
An on-line
An on-line asset management system for your buildings, backed by a national network of professionally certified contracting companies.
Navigationshilfe Ty
An on-line asset management system for your buildings, backed by a national network of professionally certified contracting companies.
Navigationshilfe Ty
25 Hard Dollar
Hard Dollar
Hard Dollar BID*BUILD is a comprehensive suite of fully integrated estimating and construction management software modules that were engineered to specifically to manage the rigorous demands of infrastructure contracting.
 Software Support Estimating Cost Partners Project Management Dollar Contact Hd Hard Corporation Case Events Resellers Epcm Training Watch
Hard Dollar BID*BUILD is a comprehensive suite of fully integrated estimating and construction management software modules that were engineered to specifically to manage the rigorous demands of infrastructure contracting.
 Software Support Estimating Cost Partners Project Management Dollar Contact Hd Hard Corporation Case Events Resellers Epcm Training Watch
26 Micromen Building Software Solutions
Micromen Building
Micromen Building Solutions provides construction software package covering all contracting agreements cost estimation.
Erp Construction Development Application Software Chennai Management Company Applications Website Services Mobile Design Php Rich
Micromen Building Solutions provides construction software package covering all contracting agreements cost estimation.
Erp Construction Development Application Software Chennai Management Company Applications Website Services Mobile Design Php Rich
27 ACEN - The Construction Internet
ACEN is
ACEN is a network of design, engineering, architectural, interior decorating, construction, supplier, contracting, developer, real estate and municipal construction experts. ACEN Exchanges and ACEN Directory of Construction Experts are a resource for our Members.
Website Web Hosting Business Websites Room Software Login Design Email Heavy Duty Working Stories Page
ACEN is a network of design, engineering, architectural, interior decorating, construction, supplier, contracting, developer, real estate and municipal construction experts. ACEN Exchanges and ACEN Directory of Construction Experts are a resource for our Members.
Website Web Hosting Business Websites Room Software Login Design Email Heavy Duty Working Stories Page
5. Sports Websites concerning Contracting
6. Society, Arts and Contracting Crafts
1 roel consulting group
california firm
california firm, with expertise in general contracting and construction forensics.
Z Y
california firm, with expertise in general contracting and construction forensics.
Z Y
2 hollaway & gumbert
houston law
houston law firm, emphasizing health law, managed care contracting and disputes, and provider reimbursement.
Version Welcome Enterhtml Z
houston law firm, emphasizing health law, managed care contracting and disputes, and provider reimbursement.
Version Welcome Enterhtml Z
3 gary a. kendra, pc
services for
services for corporate, intellectual property, contracting and real estate related transactions, from offices in northville.
Kendra Detroit Privacy Policy Info@kendralawcom Firm Centre Matters Gary Cady Effective Entireintellectual Address
services for corporate, intellectual property, contracting and real estate related transactions, from offices in northville.
Kendra Detroit Privacy Policy Info@kendralawcom Firm Centre Matters Gary Cady Effective Entireintellectual Address
4 william m. sharpe
toronto attorney
toronto attorney, offering representation for maritime, transportation, admiratly, and transport contracting matters, and arbitration.
Maritime Canadian Canada Marine Association Shipping International Transportation Toronto Law Court Cmla Ship Federal Ontario Society Seventh Owner Ships
toronto attorney, offering representation for maritime, transportation, admiratly, and transport contracting matters, and arbitration.
Maritime Canadian Canada Marine Association Shipping International Transportation Toronto Law Court Cmla Ship Federal Ontario Society Seventh Owner Ships
5 donley construction consultants
general contracting
general contracting experts specializing in defects, delays, scheduling, safety and labor efficiency disputes.
Construction Witness Expert Services Angeles | Contact Consulting Donley Resolution Consultants Approach Process Resources Project
general contracting experts specializing in defects, delays, scheduling, safety and labor efficiency disputes.
Construction Witness Expert Services Angeles | Contact Consulting Donley Resolution Consultants Approach Process Resources Project
6 roel construction company
san diego-based
san diego-based firm, with expertise in general contracting and construction forensics. includes services, careers, and contacts.
Z Y
san diego-based firm, with expertise in general contracting and construction forensics. includes services, careers, and contacts.
Z Y
7 john d. pellegrin, pc
practicing before
practicing before regulatory agencies, and offering services for intellectual property, legislation and government relations, international communications, start-up ventures and government contracting.
practicing before regulatory agencies, and offering services for intellectual property, legislation and government relations, international communications, start-up ventures and government contracting.
8 john d. pellegrin, pc
burke firm
burke firm, practicing before regulatory agencies, and offering services for intellectual property, legislation and government relations, international communications, start-up ventures and government contracting.
Freizeitler Rss Wordpress Posts ã‚«ãÆ’©ã‚³ãÆ’³ Design ã‚«ãÆ’©ã‚³ãÆ’³é€š販サイトã®便利ãªã‚¢ãÆ’â€â€ãÆ’ªã«ã¤ã„㦠年月æÃ†â€™Ã¢â‚¬Â¦å ±&a
burke firm, practicing before regulatory agencies, and offering services for intellectual property, legislation and government relations, international communications, start-up ventures and government contracting.
Freizeitler Rss Wordpress Posts ã‚«ãÆ’©ã‚³ãÆ’³ Design ã‚«ãÆ’©ã‚³ãÆ’³é€š販サイトã®便利ãªã‚¢ãÆ’â€â€ãÆ’ªã«ã¤ã„㦠年月æÃ†â€™Ã¢â‚¬Â¦å ±&a
9 watt, tieder, hoffar & fitzgerald, llp
services for
services for construction law, government contracting, surety issues, commercial real estate, international development, and labor and employment, from offices in virginia, california, the district of columbia, and italy.
Watt Tieder Summer Construction Fitzgerald World Take Industries Legal Rankedavailable Hoffar Contracts Government
services for construction law, government contracting, surety issues, commercial real estate, international development, and labor and employment, from offices in virginia, california, the district of columbia, and italy.
Watt Tieder Summer Construction Fitzgerald World Take Industries Legal Rankedavailable Hoffar Contracts Government
10 orbital engineering and consulting
find out
find out about forensic engineering services, including fire cause and origin, as well as electrical contracting and design services.
Consulting Engineering Orbital Services Design Forensic Charleston House Sottile Resume Llc Schedule Contact Carolina Engineering We Offers
find out about forensic engineering services, including fire cause and origin, as well as electrical contracting and design services.
Consulting Engineering Orbital Services Design Forensic Charleston House Sottile Resume Llc Schedule Contact Carolina Engineering We Offers
11 no cronyism in iraq
'the premise
'the premise of the accusations [of cronyism] is completely contrary to the way government contracting works, both in theory and in practice.' by steven kelman, former administrator of office of federal procurement policy. [washington post]
News Dc Terms Post World Washington Business National Politics Sports Gop Debate Local Sale Opinions Black White Photo Way
'the premise of the accusations [of cronyism] is completely contrary to the way government contracting works, both in theory and in practice.' by steven kelman, former administrator of office of federal procurement policy. [washington post]
News Dc Terms Post World Washington Business National Politics Sports Gop Debate Local Sale Opinions Black White Photo Way
12 metz, hauser & husband, p.a.
practices in
practices in the areas of legislative and governmental affairs, federal and state trial and appellate litigation, administrative law and litigation, health care, public contracting, general business and corporate law.
Law Appellate State Contracting Firm Litigation Daughton Metz Governmental Husband Schoonover Clients Black Liby Team Port
practices in the areas of legislative and governmental affairs, federal and state trial and appellate litigation, administrative law and litigation, health care, public contracting, general business and corporate law.
Law Appellate State Contracting Firm Litigation Daughton Metz Governmental Husband Schoonover Clients Black Liby Team Port
13 davey & brogan, pc
law firm
law firm specializing in admiralty and maritime law, government contracting, international trade, and related fields. profiles of the attorneys, firm, and practice areas available, as well as links to related legal resources.
Brogan Pc Daveyy
law firm specializing in admiralty and maritime law, government contracting, international trade, and related fields. profiles of the attorneys, firm, and practice areas available, as well as links to related legal resources.
Brogan Pc Daveyy
14 Minority Business Entrepreneur Magazine
A bimonthly
A bimonthly publication for and about minority and women business owners. We focus on affirmative action and contracting issues. We also offer information on Womens Business Exclusive, a newsletter exclusively for women business owners.
A bimonthly publication for and about minority and women business owners. We focus on affirmative action and contracting issues. We also offer information on Womens Business Exclusive, a newsletter exclusively for women business owners.
1 Smith, Victoria
Hot rock
Hot rock photography, fashion and portraits. Primarily documenting the San Francisco music scene, and contracting to worldwide publications, agencies and individuals.
Hot rock photography, fashion and portraits. Primarily documenting the San Francisco music scene, and contracting to worldwide publications, agencies and individuals.
2 Freelance Contractors Directory
Search a
Search a directory focusing on freelance or contracting services.
Search a directory focusing on freelance or contracting services.
Contracting Dictionary
catching contracting: becoming infected, "catching cold is sometimes unavoidable", "the contracting of a serious illness can be financially catastrophic"SiteBook.org Reviews for Contracting. The business hours may vary on holidays like Valentines Day, Washingtons Birthday, St. Patricks Day, Easter, Easter eve and Mothers day - Statistics: 3 SiteBook Points for "Contracting" (visitors of this topic page). Contracting › Reviews & Experience Experience and Review Contracting Opening Times and Reports. Date: