Contractor
1 Home Quality Remodeling Remodeling
homequalityremodeling.com/ We Remodeling General Concord San Home If What Jose Ave Contractor Office Quality Suite End
94520
Concord
We always put the home remodeling and renovating needs of our clients first. We continuously strive to be market leaders...Concord
homequalityremodeling.com/ We Remodeling General Concord San Home If What Jose Ave Contractor Office Quality Suite End
2 Diamond in the Rough Property Solutions Contractor
diamondintheroughllcoh.com/ We Canton Call
44681
Sugarcreek
Diamond In The Rough Property Solutions is a custom interior remodel contractor specializing in custom kitchens and bathrooms. We are...Sugarcreek
diamondintheroughllcoh.com/ We Canton Call
3 Looking for Corporate Waterproofing Contractor Odisha Waterroofing
buildingkadoctor.com/water-proofing.html We Applying No It After Waterproofing This Our Cleaning Ka Doctor The Steps Advantages Building
75100
Bhubaneswar
BuildingKaDoctor the most preferred waterproofing service provider providing top-notch services under a competitive market price....Bhubaneswar
buildingkadoctor.com/water-proofing.html We Applying No It After Waterproofing This Our Cleaning Ka Doctor The Steps Advantages Building
4 CMi Air Conditioning & Electrical HVAC Contractor
cmi air conditioning & electrical
33403
Lake Park
CMi has been serving residents and businesses in Palm Beach, Martin and St. Lucie Counties since 1992. So, we’ve been...Lake Park
cmi air conditioning & electrical
5 Edwards Air Ent LLC HVAC Contractor
edwardsairenterprise.com
33458
Florida City
Edwards Air Ent LLC is a full-service HVAC contractor that offers air-conditioning installation, maintenance, and repair services for heating and...Florida City
edwardsairenterprise.com
6 Liberty Hill Fence Company Fencing
libertyhillfencecompany.com/ Fence Liberty Hill Fencing Newtown Contractor Installation We Repair Company Our Fences Contact Best Commercial
78642
Liberty Hill
Top-quality Fencing in Liberty Hill, TX
We are Liberty Hill’s Top fence builder and we are here to provide world class...Liberty Hill
libertyhillfencecompany.com/ Fence Liberty Hill Fencing Newtown Contractor Installation We Repair Company Our Fences Contact Best Commercial
7 Gonzales Custom Decking CONTRACTOR
57 country road 4702
78629
Gonzales
Master Deck Builder in Gonzales, TX
At Gonzales Custom Decking we offer a wide range of services to create the ultimate...Gonzales
57 country road 4702
8 Bulverde Fence Contractor Pros FENCE CONTRACTOR
bulverdefencing.com/ Fence Bulverde Fencing Contractor Newtown Installation We Repair Best Our Fences Company Contact Professional Commercial
78163
Bulverde
Bulverde Fence Contractor Pros
2482 Hiline Dr Unit 101, Bulverde, TX 78163, United States
+18302515461
https://bulverdefencing.com/
https://www.google.com/maps?cid=3086992068660255106
Premier fencing contractor in Bulverde
We are Bulverde Fence...Bulverde
bulverdefencing.com/ Fence Bulverde Fencing Contractor Newtown Installation We Repair Best Our Fences Company Contact Professional Commercial
9 Bannister Heating and Air of Tyler HVAC
bannisterplumbingandair.com/hvac-tyler/ Tyler Air Bannister Heating We Our Plumbing Font Texas Services If Water Contractor Jacksonville East
75702
Tyler
Top Rated HVAC Contractor in Tyler, TX
Bannister Heating and Air of Tyler, Our HVAC experts have been helping customers maintain...Tyler
bannisterplumbingandair.com/hvac-tyler/ Tyler Air Bannister Heating We Our Plumbing Font Texas Services If Water Contractor Jacksonville East
10 LOS ANGELES CONCRETE & FRAMING CO Concrete Contractor
lacfco.com/ Concrete Framing Angeles Los Co Contractor We Us Services Get More Southern California Read Our
91324
Northridge
Trusted concrete contractor in Los Angeles, Los Angeles Concrete and Framing CO is your go-to source for high-quality concrete services...Northridge
lacfco.com/ Concrete Framing Angeles Los Co Contractor We Us Services Get More Southern California Read Our
11 Bathroom Remodeling Contractor In CA Home Additions
greentechremo.com/bathroom-remodeling-california Ba Objectassign Kcp Rp Kri Rt Kvo Stylable Mp Rex Hl Rl Datenow Functionconst Mathmax
91607
Los Angeles
Green Tech Remodeling & Design INC has been a trusted name for Bathroom Remodeling for years. Our Bathroom Remodeling Contractor...Los Angeles
greentechremo.com/bathroom-remodeling-california Ba Objectassign Kcp Rp Kri Rt Kvo Stylable Mp Rex Hl Rl Datenow Functionconst Mathmax
12 Bannister Plumbing & Air Services
bannisterplumbingandair.com/ Plumbing Jacksonville Air Bannister Texas East Tyler Font Contractor Water Plumber Cleaning Call We Heaters
75766
Jacksonville
Bannister Plumbing & Air is the company to call for all your plumbing & HVAC needs. We work with residential...Jacksonville
bannisterplumbingandair.com/ Plumbing Jacksonville Air Bannister Texas East Tyler Font Contractor Water Plumber Cleaning Call We Heaters
13 NorthCraft Deck Staining Services Deck Staining
northcraft-deck-staining-services.com Deck Staining Company Regular Fence Play Cleaning Washing Sealing Services Painting Regularwoff Contractor Service North
60137
Glen Ellyn
Deck staining and cleaning services. Professional deck or fence painting and sealing company....Glen Ellyn
northcraft-deck-staining-services.com Deck Staining Company Regular Fence Play Cleaning Washing Sealing Services Painting Regularwoff Contractor Service North
14 Pflugerville Expert Roofers Roofing Contractor
roofingpros-pflugervilletx.com/ Roofing Pflugerville Roofers Expert Roof We Pros Contractors Contact Commercial Residential Repair New The Company
78660
Pflugerville
ROOFING CONTRACTOR OF PFLUGERVILLE, TX
We are your locally owned and operated full-service storm restoration team. We pride ourselves on providing...Pflugerville
roofingpros-pflugervilletx.com/ Roofing Pflugerville Roofers Expert Roof We Pros Contractors Contact Commercial Residential Repair New The Company
15 B.C. Fence Home Improvement
A Fencing Company specializes in providing high-quality fencing solutions for a variety of needs. B.C. Fence offers installation, repair, and...
bcfenceaustin.com/ Fence Code Austin Fencing Company Installation Commercial We Park Contractor Cedar Arial Helvetica Fences Repair
bcfenceaustin.com/ Fence Code Austin Fencing Company Installation Commercial We Park Contractor Cedar Arial Helvetica Fences Repair
16 EME Flooring Flooring Contractor
emeflooring.com Flooring Atlanta Company Installation Our Commercial Georgia Smyrna Brookhaven Marbleton East Point Residential Luxury Vinyl
30307
Atlanta
We are a flooring company that provides installation and repairs for tiles, vinyl, laminate, hardwood, and carpet flooring. We also...Atlanta
emeflooring.com Flooring Atlanta Company Installation Our Commercial Georgia Smyrna Brookhaven Marbleton East Point Residential Luxury Vinyl
17 Home Improvement Contractor - Zicklin Contracting Construction
99 wall st suite 1960, new york, ny
10005
New York
For the best Home Improvement Contractor In The New York Area, you can trust Zicklin contracting. Our track record of...New York
99 wall st suite 1960, new york, ny
18 General Contractor in Orlando General Contractors
Benchmark Building Group is a Trusted General Contractor Orlando catering to Commercial and Residential Construction Clients in Central Florida. As...
benchmarkbuildinggroup.com Orlando Construction Florida Contractor Building General Commercial Company Outs Central Renovations Build Benchmark Group Custom
benchmarkbuildinggroup.com Orlando Construction Florida Contractor Building General Commercial Company Outs Central Renovations Build Benchmark Group Custom
19 Manassas Concrete Co Concrete Contractor
manassasconcrete.com/ Concrete Manassas We Pros The Contractor Co Our What Learn They No You Service Services
20111
Manassas
Our team of experts has years of experience in the industry, and we’re dedicated to delivering superior service to each...Manassas
manassasconcrete.com/ Concrete Manassas We Pros The Contractor Co Our What Learn They No You Service Services
20 Paskoski Construction General Contractor
paskoskiconstruction.com/ Home Construction Florida Paskoski South Fort Lauderdale Builder Inc Luxury Letter Beach Us Custom Estate
33316
Fort Lauderdale
Paskoski Construction has established a distinguished reputation for its rigorous approach to custom home building. It has professional General Contractor...Fort Lauderdale
paskoskiconstruction.com/ Home Construction Florida Paskoski South Fort Lauderdale Builder Inc Luxury Letter Beach Us Custom Estate
21 Cliff Nicholls Roofing & Scaffolding Limited Roofing Contractor
cliffnicholls.co.uk/ Roofing Wolverhampton Cliff Nicholls Roof Contractors Our Repairs Get Rubber Find We Work Call Flat
113
Wolverhampton
Cliff Nicholls is an established roofing contractor in Wolverhampton; they offer services from storm damage work to tiling and slating...Wolverhampton
cliffnicholls.co.uk/ Roofing Wolverhampton Cliff Nicholls Roof Contractors Our Repairs Get Rubber Find We Work Call Flat
22 Floor Sanding Melbourne Flooring Contractor
floorsandingmelbourne.com/ Poppins Roboto Sans Open Melbourne Arial Helvetica Lucida We Floor Sanding Uv Contact Polishing With
3216
Melbourne
At our company, we are proud to offer top-quality timber floor sanding services in Melbourne.Our team of experienced sanders uses...Melbourne
floorsandingmelbourne.com/ Poppins Roboto Sans Open Melbourne Arial Helvetica Lucida We Floor Sanding Uv Contact Polishing With
23 Cliff Nicholls Roofing Contractors Roofing Contractor
cliffnicholls.co.uk/ Roofing Wolverhampton Roof Cliff Nicholls Contractors Repairs Our Get Find Work We Rubber Flat Call
113
Wolverhampton
Cliff Nicholls is an established roofing contractor in Wolverhampton; they offer services from storm damage work to tiling and slating...Wolverhampton
cliffnicholls.co.uk/ Roofing Wolverhampton Roof Cliff Nicholls Contractors Repairs Our Get Find Work We Rubber Flat Call
24 Burberry Construction LLC Roofing Contractor
burberryconstruction.com/ Construction Burberry Repair Installation New Jersey Roof We Shingle Flat Rubber Slate Services Home Get
07747
Matawan
Specializes in Roofing and Bathroom Remodeling! We will assist with material choice, design, and complete
the installation or remodeling to...Matawan
burberryconstruction.com/ Construction Burberry Repair Installation New Jersey Roof We Shingle Flat Rubber Slate Services Home Get
25 Green Kings Landscaping Landscaping Services
greenkingslandscaping.com.au/ White Text Kings Landscaping Green Melbourne Blue Divider Designers Contractor Get Nitro Landscape Professional Ufunctione
3029
Melbourne
Green Kings Landscaping is Melbourne located business and offering various services such as Deck Builder, Excavation & Hire Service, Grounds...Melbourne
greenkingslandscaping.com.au/ White Text Kings Landscaping Green Melbourne Blue Divider Designers Contractor Get Nitro Landscape Professional Ufunctione
26 Custom Wooden Driveway Gates Dallas TX Home Service
If you are in search of a trustworthy company to build and install Custom Wooden Driveway Gates & wood fence...
prestonhollowfence.com/ Fence Automatic Driveway Gates Wood Richardson Hollow Contractor Gate Custom Cedar Railings Finest Arial Contractors
prestonhollowfence.com/ Fence Automatic Driveway Gates Wood Richardson Hollow Contractor Gate Custom Cedar Railings Finest Arial Contractors
27 Custom Driveway Gates Richardson TX Home Service
prestonhollowfence.com/ Fence Automatic Driveway Gates Wood Richardson Hollow Contractor Gate Custom Cedar Railings Finest Arial Contractors
75081
Richardson
At Preston Hollow Fence Company, we offer Custom Driveway Gate in Richardson TX, Dallas TX and surrounding areas that are...Richardson
prestonhollowfence.com/ Fence Automatic Driveway Gates Wood Richardson Hollow Contractor Gate Custom Cedar Railings Finest Arial Contractors
28 Steamatic of Grand Forks Air Duct
steamaticrrv.com/ Red River Valley Restoration Near Fargo Grand Forks Steamatic Dateget Cleanup Call Stringfrom Arial Arrayflag
58203
Grand Forks
We have been in the restoration and cleaning business for over 20 years. Our professionally trained employees specialize in providing...Grand Forks
steamaticrrv.com/ Red River Valley Restoration Near Fargo Grand Forks Steamatic Dateget Cleanup Call Stringfrom Arial Arrayflag
29 Mr. Rooter Plumbing of Phoenix Arizona Plumber Contractor
mrrooter.com/phoenix
85210
Mesa
Mr. Rooters singular priority is to provide the highest level of customer service. This is done by providing a world-class...Mesa
mrrooter.com/phoenix
30 Wooden Fence Contractors Richardson TX Contractors
RichardsonHere at Preston Hollow Fence Company, we have a team of professional Wooden Fence Contractors in Richardson TX that are...
prestonhollowfence.com/ Fence Automatic Driveway Gates Wood Richardson Hollow Contractor Gate Custom Cedar Railings Finest Arial Contractors
Richardson
prestonhollowfence.com/ Fence Automatic Driveway Gates Wood Richardson Hollow Contractor Gate Custom Cedar Railings Finest Arial Contractors
31 Fence Company in Addison Texas Home Improvement
prestonhollowfence.com/about/ Fence Company Contractor Construction Professional Dallas Automatic Gates Slide Gate Arrayflag Richardson Hollow Preston Arial
75081
Richardson
If you are wondering for security, style, or privacy, we have the best fencing solution for your property, your yard...Richardson
prestonhollowfence.com/about/ Fence Company Contractor Construction Professional Dallas Automatic Gates Slide Gate Arrayflag Richardson Hollow Preston Arial
32 Roofing Contractor in Ijamsville MD Home Improvement
easternext.com Index Storm Restoration Opening Ijamsville Name More Services Roofing Siding Contractor They Exteriors About Damage
21754
Ijamsville
Eastern Exteriors, LLC Specialize in Roofing and Storm Damage Restoration in Ijamsville, MD. Let Us Restore Your Home With a...Ijamsville
easternext.com Index Storm Restoration Opening Ijamsville Name More Services Roofing Siding Contractor They Exteriors About Damage
33 Fitzgerald Plumbing Plumnbing And
fitzplumbing.com Plumbing Lakewood Affordable Local Contractor Plumber Stringfrom Arial Arrayflag Status Loaded Transient Mathroundh Get Call
90712
Lakewood
Fitzgerald Plumbing promises availability. We love helping our neighbors fix their plumbing problems. For us, it’s all about seeing the...Lakewood
fitzplumbing.com Plumbing Lakewood Affordable Local Contractor Plumber Stringfrom Arial Arrayflag Status Loaded Transient Mathroundh Get Call
34 Electrical Contractor West Palm Beach Electrical
Want to hire State Certified Electrical Contractor in Delray Beach or West Palm Beach for your residential, commercial and industrial...
alphatecelectric.com/ Beach Palm About West Electrician Us Electric Alphatec We Electrical Alpha County Services Skip Contact
alphatecelectric.com/ Beach Palm About West Electrician Us Electric Alphatec We Electrical Alpha County Services Skip Contact
35 Parking Lot Maintenance Paving Contractor
parkinglm.com Parking Lot Maintenance We Louis Read Sealcoating Saint Our Sealing St Contact White Paper Lots
63367
Lake St Louis
Incorporated in 1997, Parking Lot Maintenance specializes in the maintenance of asphalt parking lots. Our services include seal coating, hot...Lake St Louis
parkinglm.com Parking Lot Maintenance We Louis Read Sealcoating Saint Our Sealing St Contact White Paper Lots
36 XS Worldwide - Exhibition Stand Contractor Exhibition Stand
DubaiLooking for exhibition stand contractors? Want to showcase your brand in a unique way? XS Productions Worldwide is here to...
xsproductions.com/
Dubai
xsproductions.com/
37 Sears Heating & Cooling HVAC Contractor
searsheatingcooling.com
43224
Columbus
Sears Heating and Cooling was founded in Columbus, Ohio in 1950 by Johnny Sears and his family. We are family...Columbus
searsheatingcooling.com
1 Contractor Umbrella
Provides an
Provides an administrative and payroll solution to IT contractor clients who do not wish to set up their own limited company.
Umbrella Company Contractor Contractors Companies Ir Hmrc Compliance Gt Expenses Contract Contracting Take Limited Awr
Provides an administrative and payroll solution to IT contractor clients who do not wish to set up their own limited company.
Umbrella Company Contractor Contractors Companies Ir Hmrc Compliance Gt Expenses Contract Contracting Take Limited Awr
2 AJECT
Contractor operating
Contractor operating in the Middle East, tunnelling as a specialist contractor.
Z Aject Y
Contractor operating in the Middle East, tunnelling as a specialist contractor.
Z Aject Y
3 Charles Blanchard Construction Corporation
Licensed general
Licensed general contractor and historic restoration contractor in Charleston, South Carolina.
Division Construction Commercial Charles Blanchard Charleston Mechanical Corporation Industrial Cbcc Historical Team Email Upcoming Project
Licensed general contractor and historic restoration contractor in Charleston, South Carolina.
Division Construction Commercial Charles Blanchard Charleston Mechanical Corporation Industrial Cbcc Historical Team Email Upcoming Project
4 R.C. Austin
25 years
25 years as an electrical contractor serving Port Carling & Muskoka Lakes cottages and homes. An experienced electrical contractor.
Electrical Muskoka Contractor Port Systems Lighting Carling Plumbing Lakes Austin Generators Rc Homes Commercial Businesses
25 years as an electrical contractor serving Port Carling & Muskoka Lakes cottages and homes. An experienced electrical contractor.
Electrical Muskoka Contractor Port Systems Lighting Carling Plumbing Lakes Austin Generators Rc Homes Commercial Businesses
5 RB Enterprises Electrical Contractor
Electrical contractor
Electrical contractor with over 20 years experience. Commercial & residential serving El Paso, TX & surrounding Communities. Licensed & Bonded.
Electrical contractor with over 20 years experience. Commercial & residential serving El Paso, TX & surrounding Communities. Licensed & Bonded.
6 Sprinkler System Contractor
Full Service
Full Service Fire Sprinkler Contractor Proudly Serving the Southeast Since 1978 Headquartered in High Point, North Carolina
Sprinkler Systems Sunland Fire Protection Carolina Office Employment Automatic Services Projects Contact Quality Tennessee Afsa Point Virginia
Full Service Fire Sprinkler Contractor Proudly Serving the Southeast Since 1978 Headquartered in High Point, North Carolina
Sprinkler Systems Sunland Fire Protection Carolina Office Employment Automatic Services Projects Contact Quality Tennessee Afsa Point Virginia
7 Contractor Financials Ltd
Offers contractor
Offers contractor mortgages, insurance, pension and life insurance.
Contractor Mortgages Insurance Mortgage Pensions Guide Protection Income Life Financial Click Here Critical Pension Personal First Writing
Offers contractor mortgages, insurance, pension and life insurance.
Contractor Mortgages Insurance Mortgage Pensions Guide Protection Income Life Financial Click Here Critical Pension Personal First Writing
8 Insul-Crete Concrete Floor Roof Sound Geotechnical Installation Contractor Fresno CA
The leading
The leading construction contractor installing lightweight cellular concrete, gypsum based underlayments and insulating concrete roof systems.
Z Y
The leading construction contractor installing lightweight cellular concrete, gypsum based underlayments and insulating concrete roof systems.
Z Y
9 Central Service and Supply
Serves the
Serves the construction, aggregate, mining and contractor market segments with rock crushing equipment, screening plants, wire cloth, pumps, chains & hoists, washing & classifying equipment, drilling equipment, conveying equipment and contractor equipment rental.
Learn Equipment Supply Learnmore Central Water Pumps Inc Mining Products Slings Hoists Moines Lifting Studios Crushers Chain Catalog
Serves the construction, aggregate, mining and contractor market segments with rock crushing equipment, screening plants, wire cloth, pumps, chains & hoists, washing & classifying equipment, drilling equipment, conveying equipment and contractor equipment rental.
Learn Equipment Supply Learnmore Central Water Pumps Inc Mining Products Slings Hoists Moines Lifting Studios Crushers Chain Catalog
10 School Floor Contractor
School and
School and sport floor contractor.
School and sport floor contractor.
11 Afmac LTD
Salisbury, UK
Salisbury, UK HVAC contractor.
Salisbury, UK HVAC contractor.
12 Geophysique TMC
A Canadian
A Canadian geophysical contractor.
A Canadian geophysical contractor.
13 Spartansales.com
contractor supplies
contractor supplies and materials.
Now Sale Request Domain Domainmarketcom Price Spartansalescom Buy @ Spartansalescom_thispricenow Welcome Z
contractor supplies and materials.
Now Sale Request Domain Domainmarketcom Price Spartansalescom Buy @ Spartansalescom_thispricenow Welcome Z
14 PC Exploration
A drilling
A drilling services contractor.
A drilling services contractor.
16 Chillaire. Ltd.
Full service
Full service UK HVAC contractor.
Chillaire Conditioning Systems Heat Design Solutions Contract Pumps News Maintenance Industrial Installation Consultancy Showers Air Residential Citb Europe Manager Close
Full service UK HVAC contractor.
Chillaire Conditioning Systems Heat Design Solutions Contract Pumps News Maintenance Industrial Installation Consultancy Showers Air Residential Citb Europe Manager Close
19 Soter Construction
Foamed asphalt
Foamed asphalt contractor.
Robichaud Contactcanadarobert Goodfellow Fax Delson
Foamed asphalt contractor.
Robichaud Contactcanadarobert Goodfellow Fax Delson
20 Dynamic Services
Melbourne, Australia
Melbourne, Australia HVAC contractor.
Z Here Visiting Upload Optusnet Soonif Homepage Another Owner Cablemembers Optus Internet
Melbourne, Australia HVAC contractor.
Z Here Visiting Upload Optusnet Soonif Homepage Another Owner Cablemembers Optus Internet
21 Chill Out Air Conditioning
Residential /
Residential / commercial HVAC contractor.
Airconditioning Tenerife Fixit Frankie Browser Heating Refrigeration Supportdoes Cooling Pleasewwwfrankiefixitcom
Residential / commercial HVAC contractor.
Airconditioning Tenerife Fixit Frankie Browser Heating Refrigeration Supportdoes Cooling Pleasewwwfrankiefixitcom
22 Masley, Gregory
Network engineer
Network engineer and contractor. CNA, CNE, MCSE.
Network engineer and contractor. CNA, CNE, MCSE.
23 JC Heat & Tile
Sub-floor radient
Sub-floor radient heating contractor.
Sub-floor radient heating contractor.
24 The Contractor Pages
A national
A national building trades directory.
Wordpress Hello World Contractor Uncategorized Blog Page Sample Rss Wordpressorg Pages Entries Proudlymr
A national building trades directory.
Wordpress Hello World Contractor Uncategorized Blog Page Sample Rss Wordpressorg Pages Entries Proudlymr
25 S&D Service Co.
Victoria, TX
Victoria, TX based residential HVAC contractor.
Conditioning Residential Air Heating Texas Victoria Sd Information Specializing Heat Cooling Sndaccom Webmail Services Andmodels
Victoria, TX based residential HVAC contractor.
Conditioning Residential Air Heating Texas Victoria Sd Information Specializing Heat Cooling Sndaccom Webmail Services Andmodels
26 G.M.S.
Full service
Full service HVAC contractor based in Mifflinburg, PA.
Full service HVAC contractor based in Mifflinburg, PA.
27 Metro Heating & Cooling
Pittsburgh, PA
Pittsburgh, PA residential HVAC contractor.
Pittsburgh, PA residential HVAC contractor.
28 All Seasons Heating and Cooling
Green Bay
Green Bay, WI residential HVAC contractor.
Green Contractor Roofing Hvac Contractors Domain Suspended Bayz
Green Bay, WI residential HVAC contractor.
Green Contractor Roofing Hvac Contractors Domain Suspended Bayz
29 Tenix Group
Defence and
Defence and technology systems integrator and contractor.
Tenix Awards Water Sustainability News Publications Privacy Wastewater Australia Use Contact Working Development Gt Environment Terms Finalist Sponsor
Defence and technology systems integrator and contractor.
Tenix Awards Water Sustainability News Publications Privacy Wastewater Australia Use Contact Working Development Gt Environment Terms Finalist Sponsor
30 C and C Construction Co., Inc.
Full service
Full service facility maintenance services contractor.
Full service facility maintenance services contractor.
31 Veterans Service Co., LLC
Woodstock, CT.
Woodstock, CT. residential / commercial HVAC contractor.
Woodstock, CT. residential / commercial HVAC contractor.
32 Skylake Heating and Air Conditioning
Sandy, UT
Sandy, UT residential HVAC contractor.
Sandy, UT residential HVAC contractor.
33 Airstron
Ft. Lauderdale
Ft. Lauderdale, FL. full service commercial HVAC contractor.
Hvac Airstron Coming Soon Salesz
Ft. Lauderdale, FL. full service commercial HVAC contractor.
Hvac Airstron Coming Soon Salesz
34 UDC Corporation
Industrial and
Industrial and commercial general contractor. Anaheim, California, USA.
Industrial and commercial general contractor. Anaheim, California, USA.
35 Jav-air Heating & Air Conditioning
Lakewood, CA
Lakewood, CA residential / commercial HVAC contractor.
Lakewood, CA residential / commercial HVAC contractor.
36 Reynolds, Inc.
Utility contractor
Utility contractor specializing in water and wastewater systems.
Utility contractor specializing in water and wastewater systems.
37 Air Essentials
Vacaville, Ca.
Vacaville, Ca. residential full service HVAC contractor.
Vacaville, Ca. residential full service HVAC contractor.
39 The DFH Company, Inc.
Residential -
Residential - Commercial HVAC contractor based in Louisville, KY.
Z Y
Residential - Commercial HVAC contractor based in Louisville, KY.
Z Y
40 YardBids
Landscaping bids
Landscaping bids and contractor directory where a job can be posted anonymously.
Psa Rbs Gs Wfc Bac Nee Bbt Usb Ms Kim Jpm Frc Dlr Bcs Nmih Rell Cnce
Landscaping bids and contractor directory where a job can be posted anonymously.
Psa Rbs Gs Wfc Bac Nee Bbt Usb Ms Kim Jpm Frc Dlr Bcs Nmih Rell Cnce
41 Wallace A/C & Heating Co.
Sealy, TX
Sealy, TX residential/commercial HVAC contractor.
Wallace Heating Instantpage Poweredair [[domain]] Godaddycom See Daddygo Want Httpwallacehvaccom
Sealy, TX residential/commercial HVAC contractor.
Wallace Heating Instantpage Poweredair [[domain]] Godaddycom See Daddygo Want Httpwallacehvaccom
42 Contractor Guide
National directory
National directory of contractors, suppliers and manufacturers.
Contact Contractormobilelinks Read Flooring Mobile Remodelingcontractorskitchensuggestionsflooringadvice Kitchen Repairs Copyright Home * Guide * Learnguide Improvement
National directory of contractors, suppliers and manufacturers.
Contact Contractormobilelinks Read Flooring Mobile Remodelingcontractorskitchensuggestionsflooringadvice Kitchen Repairs Copyright Home * Guide * Learnguide Improvement
43 Custom Air
New England
New England full service residential HVAC contractor.
Air Custom Request Hvac Has Heating Leader Industry Superior Farms Furnace Ductwork Itself Made Gas Y
New England full service residential HVAC contractor.
Air Custom Request Hvac Has Heating Leader Industry Superior Farms Furnace Ductwork Itself Made Gas Y
44 Bell Air Heating and Air
Florissant, MO
Florissant, MO residential/commercial HVAC contractor.
Bellairhvaccom Wwwbellairhvaccom Saley
Florissant, MO residential/commercial HVAC contractor.
Bellairhvaccom Wwwbellairhvaccom Saley
45 Alcom Services Inc
Full service
Full service telecommunications and electrical contractor.
Services Contact Security Fiber Projects Electrical Optical  Inc Installations Alcom Wiring Marketing Data
Full service telecommunications and electrical contractor.
Services Contact Security Fiber Projects Electrical Optical  Inc Installations Alcom Wiring Marketing Data
46 Elite Air Inc.
New Jersey
New Jersey full service residential HVAC contractor.
New Jersey full service residential HVAC contractor.
47 Finney Heating & Air
Doraville, GA
Doraville, GA residential/commercial HVAC contractor.
Under Constructiony
Doraville, GA residential/commercial HVAC contractor.
Under Constructiony
48 Combi Services
Central heating
Central heating contractor serving Southampton, UK.
Central heating contractor serving Southampton, UK.
49 Elkins Technologies
Electrical and
Electrical and communication contractor in Aurora Illinois
Electrical and communication contractor in Aurora Illinois
50 lockheed martin -syracuse
prime contractor
prime contractor for many sonar systems.
prime contractor for many sonar systems.
51 J.T.Hickman Co., Inc.
Contractor installer
Contractor installer of Sunrooms, siding, roofs and windows
Contractor installer of Sunrooms, siding, roofs and windows
52 A-A Mechanical
Full service
Full service residential/commercial HVAC contractor.
Chicago Heating Mechanical Furnace Conditioning Repair Air Seer Certified Company Installation Boiler Carrier Rheem Coleman Great Part Forced Unico Running
Full service residential/commercial HVAC contractor.
Chicago Heating Mechanical Furnace Conditioning Repair Air Seer Certified Company Installation Boiler Carrier Rheem Coleman Great Part Forced Unico Running
53 Areas Air Conditioning
Palm Harbor
Palm Harbor, FL. residential HVAC contractor.
Palm Harbor, FL. residential HVAC contractor.
54 Krupp Uhde
Chemical engineering
Chemical engineering contractor and plant construction.
Chemical engineering contractor and plant construction.
55 wazee electric
electrical contractor
electrical contractor profile and job contact information.
Motor Repair Field Crane Wazee Electric Sales Wind Motors Generator Predictive Word Electrical Hn Mechanical Products Useful
electrical contractor profile and job contact information.
Motor Repair Field Crane Wazee Electric Sales Wind Motors Generator Predictive Word Electrical Hn Mechanical Products Useful
56 Hillestad Heating & Air Conditioning
Residential/Commercial HVAC
Residential/Commercial HVAC contractor.
Residential/Commercial HVAC contractor.
57 u.s. railways, inc.
freight railroad
freight railroad intra-plant switching contractor.
Railways Freight Intra Plant Railroad Switching Inc Ave Milwaukee Chicagoincshome Smallyou Contractor Since
freight railroad intra-plant switching contractor.
Railways Freight Intra Plant Railroad Switching Inc Ave Milwaukee Chicagoincshome Smallyou Contractor Since
58 Georgie Floors
Hardwood flooring
Hardwood flooring installation contractor in southern US.
Hardwood flooring installation contractor in southern US.
59 Opus Building Corporation
Commercial design
Commercial design build contractor.
Commercial Building Corporation Opus Optimus Contractor General Team Finish Contractors Plans Design Provides Buildingcorporation Single
Commercial design build contractor.
Commercial Building Corporation Opus Optimus Contractor General Team Finish Contractors Plans Design Provides Buildingcorporation Single
60 Nicholas Aire Systems
California based
California based residential HVAC contractor.
California based residential HVAC contractor.
61 FridgeTek
Full service
Full service commercial / industrial HVAC contractor based in UK.
Conditioning Bedfordshire Refrigeration Fridgetek Air Company Maintenance Supplier Installation Uk London Specialist News Studies Andinstallation England Case
Full service commercial / industrial HVAC contractor based in UK.
Conditioning Bedfordshire Refrigeration Fridgetek Air Company Maintenance Supplier Installation Uk London Specialist News Studies Andinstallation England Case
62 Lee Heating and Air Conditioning
Westminster, South
Westminster, South Carolina residential HVAC contractor.
Westminster, South Carolina residential HVAC contractor.
63 A Custom Heating and Air Conditioning, Inc
Full service
Full service residential HVAC contractor.
Full service residential HVAC contractor.
64 Comfy Air
Yorkshire, UK
Yorkshire, UK full service residential/commercial HVAC contractor.
Yorkshire, UK full service residential/commercial HVAC contractor.
65 DPG Plus
HVAC and
HVAC and commercial building service contractor operating throughout the United Kingdom.
HVAC and commercial building service contractor operating throughout the United Kingdom.
66 COMMUNITYII
Staten Island
Staten Island, NY full service residential HVAC contractor.
Staten Island, NY full service residential HVAC contractor.
67 Victor Distributing Company
Caters to
Caters to the licensed air conditioning and mechanical contractor.
Caters to the licensed air conditioning and mechanical contractor.
68 Central Mechanical
Residential and
Residential and commercial full service HVAC contractor.
Air Conditioning Heating Houston Commercial Request Maintenance Residential Repair Ac Contact Central Mechanical Partners
Residential and commercial full service HVAC contractor.
Air Conditioning Heating Houston Commercial Request Maintenance Residential Repair Ac Contact Central Mechanical Partners
69 Thermalair Inc.
Full service
Full service HVAC and Refrigeration contractor based in Anaheim, CA.
Conditioning Air Construction Industrial Engineering Contractor Diversity Comprising Calibration Aqmdaudits Refrigeration Distributor Full
Full service HVAC and Refrigeration contractor based in Anaheim, CA.
Conditioning Air Construction Industrial Engineering Contractor Diversity Comprising Calibration Aqmdaudits Refrigeration Distributor Full
70 BTB Australia
Australian underground
Australian underground utility contractor specializing in directional drilling.
Drilling Directional Civil Works Australia Web Ltd Btb Ideasptyprojects
Australian underground utility contractor specializing in directional drilling.
Drilling Directional Civil Works Australia Web Ltd Btb Ideasptyprojects
71 C.L. Linfoot Co.
Grand Forks
Grand Forks, ND based residential/commercial HVAC contractor.
Linfoot Cl Click Co Here Grand Video News Hvac Forks Roofing Play Above Call Schedule Custom Roof
Grand Forks, ND based residential/commercial HVAC contractor.
Linfoot Cl Click Co Here Grand Video News Hvac Forks Roofing Play Above Call Schedule Custom Roof
72 Simpson Heating and Cooling
New Philadelphia
New Philadelphia, OH residential/commercial HVAC contractor.
Heating Air Conditioning Cooling Simpson Commercial Residential Geothermal Services Systems Industry Philadelphia System Ohio New Overhead Saving Heatingtext Aligncenterfont
New Philadelphia, OH residential/commercial HVAC contractor.
Heating Air Conditioning Cooling Simpson Commercial Residential Geothermal Services Systems Industry Philadelphia System Ohio New Overhead Saving Heatingtext Aligncenterfont
73 SECCO, Inc.
Camp Hill
Camp Hill, PA residential / commercial mechanical services contractor.
Electrical Commercial Services Camp Hill Lighting Solar Pa Construction Hvacr Portfolio Hvac Refrigeration Contact Equipment Rhelmod_auth_passthrough Quicktricity
Camp Hill, PA residential / commercial mechanical services contractor.
Electrical Commercial Services Camp Hill Lighting Solar Pa Construction Hvacr Portfolio Hvac Refrigeration Contact Equipment Rhelmod_auth_passthrough Quicktricity
74 Stringliner Company
Manufacturer of
Manufacturer of line reels for the experienced contractor or the do-it-yourself handy man.
Holders Line Reels Tape Tools Extension Stringliner Construction Tool Cord Barricade Company Nylon Dispensers Where Call
Manufacturer of line reels for the experienced contractor or the do-it-yourself handy man.
Holders Line Reels Tape Tools Extension Stringliner Construction Tool Cord Barricade Company Nylon Dispensers Where Call
75 Airmasters-Services
Springfield, IL
Springfield, IL full service commercial HVAC contractor.
Springfield, IL full service commercial HVAC contractor.
76 Surety Company of the Pacific
Provider of
Provider of California contractor license bonds.
Hcc Bonds Insurance Liability Surety Life Company Professional Global Contacts Claims Risk Commercial Contract Credit Taft Hartley Protection Bbb
Provider of California contractor license bonds.
Hcc Bonds Insurance Liability Surety Life Company Professional Global Contacts Claims Risk Commercial Contract Credit Taft Hartley Protection Bbb
77 H.V.A.C. of Wisconsin, Inc.
Racine, WI
Racine, WI full service residential / commercial HVAC contractor.
Racine, WI full service residential / commercial HVAC contractor.
78 All * Right Inc.
HVAC and
HVAC and refrigeration contractor serving the Oklahoma City metro area.
HVAC and refrigeration contractor serving the Oklahoma City metro area.
79 I Chink
Chinking contractor
Chinking contractor working in the Northwest States. Information for log homeowners.
Chinking contractor working in the Northwest States. Information for log homeowners.
80 Gelidus Limited
UK full
UK full service commercial and residential HVAC contractor.
Conditioning Air Berkshire Gt Company Reading Maintenance Contact Repair Gelidus Call Design Installation Limited Environmental Lease Compliance
UK full service commercial and residential HVAC contractor.
Conditioning Air Berkshire Gt Company Reading Maintenance Contact Repair Gelidus Call Design Installation Limited Environmental Lease Compliance
81 CityITjobs.com
IT contractor
IT contractor marketplace, where employers and freelancers contract with each other using an auction format.
Z Request Y
IT contractor marketplace, where employers and freelancers contract with each other using an auction format.
Z Request Y
82 Herman Goldner Co., Inc.
Full service
Full service HVAC and plumbing contractor serving PA, NJ, DE.
Herman Goldner Mechanical Services Inc Co Project Company Philadelphia Construction Building Systems What’s Plumbing Pa Community Automation Union
Full service HVAC and plumbing contractor serving PA, NJ, DE.
Herman Goldner Mechanical Services Inc Co Project Company Philadelphia Construction Building Systems What’s Plumbing Pa Community Automation Union
83 Herman Goldner Co., Inc.
Full service
Full service HVAC and plumbing contractor serving PA, NJ, DE.
Full service HVAC and plumbing contractor serving PA, NJ, DE.
84 ACentral
Houston, TX
Houston, TX full service residential/commercial HVAC contractor.
Houston, TX full service residential/commercial HVAC contractor.
85 Benson Audio Labs, Inc.
Microphones for
Microphones for the professional musician and sound contractor.
Microphones for the professional musician and sound contractor.
86 Rayer Design Limited
Exhibiti designer
Exhibiti designer and contractor. Hong Kong.
Exhibiti designer and contractor. Hong Kong.
87 L.E.S. Heating & Air Co.
Wheeling, IL
Wheeling, IL full service residential /commercial HVAC contractor.
Wheeling, IL full service residential /commercial HVAC contractor.
88 FurnaceClean
Ontario, Canada
Ontario, Canada residential heating service and sales contractor.
Ontario, Canada residential heating service and sales contractor.
89 nabors industries, inc.
onshore and
onshore and offshore drilling, well-servicing, and workover contractor.
Drilling Services Technology Nabors Investor Learn Industries Rigs Software Land Coiled Specialty Fluids Stimulation Wireline Annual Environment Operations
onshore and offshore drilling, well-servicing, and workover contractor.
Drilling Services Technology Nabors Investor Learn Industries Rigs Software Land Coiled Specialty Fluids Stimulation Wireline Annual Environment Operations
90 1-800-Any-Tyme
AC service
AC service contractor serving Los Angeles, Riverside, San Bernardino, and San Diego, CA.
Permanently The Port Server Apachez
AC service contractor serving Los Angeles, Riverside, San Bernardino, and San Diego, CA.
Permanently The Port Server Apachez
91 Grand Parkway A/C & Heating
Sugar Land
Sugar Land, TX residential/commercial HVAC contractor.
Sugar Land, TX residential/commercial HVAC contractor.
92 T. B. Lucas Mechanical
Northern Virginia
Northern Virginia full service residential HVAC contractor.
Northern Virginia full service residential HVAC contractor.
93 Custom Heating and Air Conditioning
Full service
Full service residential/commercial HVAC contractor.
Full service residential/commercial HVAC contractor.
94 BSW Heating Limited
UK based
UK based residential/commercial full service HVAC contractor.
Heating Services Housing Social News Policy Private Charities Homes Cover Commercial Projects Servicing Renewables Maintenance Safety Recruitment Gas Engineer Hours Area
UK based residential/commercial full service HVAC contractor.
Heating Services Housing Social News Policy Private Charities Homes Cover Commercial Projects Servicing Renewables Maintenance Safety Recruitment Gas Engineer Hours Area
95 Doctor Air
Stephenville, TX
Stephenville, TX full service residential/commercial HVAC and refrigeration contractor.
Air Doctor Heating Conditioning Deviney Checklist Check Products Page Texas Financing Point Ac Refrigeration Trane Email
Stephenville, TX full service residential/commercial HVAC and refrigeration contractor.
Air Doctor Heating Conditioning Deviney Checklist Check Products Page Texas Financing Point Ac Refrigeration Trane Email
96 T. B. Lucas Mechanical
Northern Virginia
Northern Virginia full service residential HVAC contractor.
Z Y
Northern Virginia full service residential HVAC contractor.
Z Y
97 R.S. Andrews Services, Inc.
Atlanta, GA
Atlanta, GA full service residential/commercial HVAC contractor.
Conditioning Air Atlanta Andrews Rs Repair Maintenance Tips Quality Heating Installation Atlantas Current Specials Knowledge Testimonials Expert
Atlanta, GA full service residential/commercial HVAC contractor.
Conditioning Air Atlanta Andrews Rs Repair Maintenance Tips Quality Heating Installation Atlantas Current Specials Knowledge Testimonials Expert
98 Sauer Incorporated
Specialty contractor
Specialty contractor providing mechanical systems installation and service throughout the U.S..
Specialty contractor providing mechanical systems installation and service throughout the U.S..
99 Helland Heating and Air
Residential HVAC
Residential HVAC contractor serving the western suburbs of Minneapolis, MN.
Residential HVAC contractor serving the western suburbs of Minneapolis, MN.
100 VTH Mechanical Inc.
San Jose
San Jose CA. based full service residential/commercial HVAC contractor.
San Jose CA. based full service residential/commercial HVAC contractor.
101 H & H Supply
Mansfield, OH
Mansfield, OH residential / commercial full service HVAC and plumbing contractor.
Mansfield, OH residential / commercial full service HVAC and plumbing contractor.
102 J J Engineering Company
Full service
Full service commercial / industrial HVAC contractor based in UK.
Z Jjengcom Y
Full service commercial / industrial HVAC contractor based in UK.
Z Jjengcom Y
103 Excel Heating and Air Conditioning
Residential HVAC
Residential HVAC contractor located in Silver Spring, MD.
Residential HVAC contractor located in Silver Spring, MD.
104 Commercial Electric Products
An electrical
An electrical contractor and distributor. Located in Cleveland, Ohio USA.
An electrical contractor and distributor. Located in Cleveland, Ohio USA.
105 Controlled Air Systems, Inc.
Central Ohio
Central Ohio residential full service HVAC contractor.
Incsystems Controlled Air
Central Ohio residential full service HVAC contractor.
Incsystems Controlled Air
106 CWD Designs
Services for
Services for the architectural/engineering firm, contractor, small residential and individuals.
Services for the architectural/engineering firm, contractor, small residential and individuals.
107 Airinmar Ltd
The independent
The independent prime contractor for managing aircraft component overhaul and repair.
Airinmar News Repair Services Maintenance Component Locations Quality Contact Telephone Emailinfo@airinmarcom Deliversairinmar Delivering Flight Ltd Kingdom
The independent prime contractor for managing aircraft component overhaul and repair.
Airinmar News Repair Services Maintenance Component Locations Quality Contact Telephone Emailinfo@airinmarcom Deliversairinmar Delivering Flight Ltd Kingdom
108 Modern Indoor Comfort Zone
Dallas, TX
Dallas, TX residential / commercial HVAC contractor.
Dallas, TX residential / commercial HVAC contractor.
109 Sauer Incorporated
Specialty contractor
Specialty contractor providing mechanical systems installation and service throughout the U.S..
Sauer Ruthrauff Llc Incorporated Inc | Group Located Division Information Touch Corporate Contactserver
Specialty contractor providing mechanical systems installation and service throughout the U.S..
Sauer Ruthrauff Llc Incorporated Inc | Group Located Division Information Touch Corporate Contactserver
110 sommerfeld electric ltd
a full
a full service electrical contractor located in saskatoon, saskatchewan.
a full service electrical contractor located in saskatoon, saskatchewan.
111 Mahler AC and Heating, LLC
Phoenix, AZ
Phoenix, AZ full service residential/commercial HVAC contractor.
Phoenix, AZ full service residential/commercial HVAC contractor.
112 Mechanics Heating & Air
Full service
Full service HVAC contractor serving metro-Atlanta GA.
Full service HVAC contractor serving metro-Atlanta GA.
113 Elite Heating and Air Conditioning, Inc.
Louisville, KY
Louisville, KY full service residential HVAC contractor.
Z Y
Louisville, KY full service residential HVAC contractor.
Z Y
114 Priority Heating and Air Conditioning
Summerfield, FL
Summerfield, FL residential full service HVAC contractor.
Priority Well Energy Contact Tips Platinum Saving Summerfield Agreement Savings Specialowned Heating Sales
Summerfield, FL residential full service HVAC contractor.
Priority Well Energy Contact Tips Platinum Saving Summerfield Agreement Savings Specialowned Heating Sales
115 M & S Armistead, Inc.
New Jersey
New Jersey based full service industrial HVAC Mechanical Contractor.
New Jersey based full service industrial HVAC Mechanical Contractor.
116 NCO Air Systems, Inc.
Southern California
Southern California residential/commercial full service HVAC contractor.
Z Y
Southern California residential/commercial full service HVAC contractor.
Z Y
117 A-A Mechanical
Chicago, Illinois.
Chicago, Illinois. Full service residential/commercial HVAC contractor.
Chicago, Illinois. Full service residential/commercial HVAC contractor.
118 marine electric of america corp.
miami based
miami based electrical supplier and contractor.
miami based electrical supplier and contractor.
119 Schmidt Heating and Cooling
Residential HVAC
Residential HVAC contractor serving greater Cincinnati.
Contact Services Heating Leave Ready Air Uncategorized Aluminum Foil Uarr Summerquick Hvac Furnace
Residential HVAC contractor serving greater Cincinnati.
Contact Services Heating Leave Ready Air Uncategorized Aluminum Foil Uarr Summerquick Hvac Furnace
120 A Custom Heating and Air Conditioning, Inc
Chicago IL
Chicago IL full service residential HVAC contractor.
Chicago IL full service residential HVAC contractor.
121 Advanced Energy Savers, Inc.
A full
A full service residential/commercial HVAC contractor.
A full service residential/commercial HVAC contractor.
122 Hillestad Heating & Air Conditioning
Residential/Commercial HVAC
Residential/Commercial HVAC contractor. Madison, Wisconsin.
Residential/Commercial HVAC contractor. Madison, Wisconsin.
123 ModaGroup
Exhibition stand
Exhibition stand, booth design and build contractor. United Kingdom
Display Stands Exhibition Systems Portable Moda Stand Design Contractors Custom Boards Displays Trade Suppliers Panel Most
Exhibition stand, booth design and build contractor. United Kingdom
Display Stands Exhibition Systems Portable Moda Stand Design Contractors Custom Boards Displays Trade Suppliers Panel Most
124 Apex Air Conditioning
Sydney, Australia
Sydney, Australia full service commercial HVAC contractor.
Sydney, Australia full service commercial HVAC contractor.
125 Frost Brothers
Dallas, TX
Dallas, TX full service residential/commercial HVAC contractor.
Dallas, TX full service residential/commercial HVAC contractor.
126 Farina Corporation
Boston, MA
Boston, MA full service commercial/industrial HVAC contractor.
Hvac Corporation Farina Carrier And Developers Systems Leading Massachusetts Throughout Installs Melt Charlestown Radiant Cooling
Boston, MA full service commercial/industrial HVAC contractor.
Hvac Corporation Farina Carrier And Developers Systems Leading Massachusetts Throughout Installs Melt Charlestown Radiant Cooling
127 LeCher Construction
General contractor
General contractor with HVAC, dust collection, and air filtration capability.
Entries 看è·å¸«ã€€å‡†çœ‹è·å¸«ã€€æ±Ã¢â‚¬Å¡äºº Rss クãÆ’¬ã‚¸ãƒƒトカãÆ’¼ãƒ‰審査基æºÃ¢â‚¬â€œ Admin Firmasite Wordpressorg ã‚る看è·å&ce
General contractor with HVAC, dust collection, and air filtration capability.
Entries 看è·å¸«ã€€å‡†çœ‹è·å¸«ã€€æ±Ã¢â‚¬Å¡äºº Rss クãÆ’¬ã‚¸ãƒƒトカãÆ’¼ãƒ‰審査基æºÃ¢â‚¬â€œ Admin Firmasite Wordpressorg ã‚る看è·å&ce
128 Climate Solutions Inc.
Huntersville, NC
Huntersville, NC full service commercial/industrial HVAC contractor.
Huntersville, NC full service commercial/industrial HVAC contractor.
129 Four Seasons Heating and Air Conditioning, Inc.
Newberg, OR
Newberg, OR full service residential HVAC contractor.
Newberg, OR full service residential HVAC contractor.
130 A/C Control
Los Angles
Los Angles, full service residential/commercial/industrial HVAC contractor.
Los Angles, full service residential/commercial/industrial HVAC contractor.
131 Builders Heating and Air Conditioning
Denver, CO
Denver, CO full service residential/commercial HVAC contractor.
Heating Builders Quality Indoor Request Contact Air Estimate Residential Ac Manuals Accessories Credentials Financing Specials Professional News Testimonials Denver Sarah
Denver, CO full service residential/commercial HVAC contractor.
Heating Builders Quality Indoor Request Contact Air Estimate Residential Ac Manuals Accessories Credentials Financing Specials Professional News Testimonials Denver Sarah
132 Balco Heating and Cooling
Akron, OH
Akron, OH full service residential/commercial HVAC contractor.
Akron, OH full service residential/commercial HVAC contractor.
133 Punzak Air Conditioning
Locally owned
Locally owned full service residential and commercial HVAC contractor.
Locally owned full service residential and commercial HVAC contractor.
134 pike electric, inc.
power line
power line contractor in the southeast. services, locations, and contact information.
Z Y
power line contractor in the southeast. services, locations, and contact information.
Z Y
135 Around the Clock
South Florida
South Florida Based full service residential / commercial HVAC contractor.
South Florida Based full service residential / commercial HVAC contractor.
136 Mike Straddeck and Associates
Virginia Beach
Virginia Beach, VA full service residential HVAC contractor.
Virginia Beach, VA full service residential HVAC contractor.
137 E-Z Electric, Inc.
Electrical &
Electrical & telecom contractor for industrial & commercial accounts in metro Detroit since 1968.
Electrical & telecom contractor for industrial & commercial accounts in metro Detroit since 1968.
138 Frye Electric, Inc.
Commercial and
Commercial and residential electrical contractor, with over 25 years experience in central Indiana.
Commercial and residential electrical contractor, with over 25 years experience in central Indiana.
139 C&D Sheet Metal, Inc.
Full service
Full service residential and commercial HVAC contractor located in Jarretsville, MD.
Full service residential and commercial HVAC contractor located in Jarretsville, MD.
140 Work Environmental Systems
Denton, Tx.
Denton, Tx. full service residential / commercial HVAC contractor.
Denton, Tx. full service residential / commercial HVAC contractor.
141 Conditioned Air, Inc.
Full service
Full service residential/commercial/industrial HVAC contractor based in Macon, GA.
Full service residential/commercial/industrial HVAC contractor based in Macon, GA.
142 Central Mechanical
Residential and
Residential and commercial full service HVAC contractor. Houston, Texas.
Air Conditioning Heating Commercial Contact Request Residential Ac Houston Repair Surrounding Systems Texas Mechanical Y
Residential and commercial full service HVAC contractor. Houston, Texas.
Air Conditioning Heating Commercial Contact Request Residential Ac Houston Repair Surrounding Systems Texas Mechanical Y
143 Rural Productions Ltd
Exhibition stand
Exhibition stand, booth design and build contractor. United Kingdom.
Exhibition stand, booth design and build contractor. United Kingdom.
144 Solar Frost Inc.
New York
New York City full service commercial HVAC and refrigeration contractor.
Solar Frost Hvac Commercial Inc York Residential Tweet Testimonials Contracts Conditioner Citys Projects Brooklyn Premiere Radio Equipment Our
New York City full service commercial HVAC and refrigeration contractor.
Solar Frost Hvac Commercial Inc York Residential Tweet Testimonials Contracts Conditioner Citys Projects Brooklyn Premiere Radio Equipment Our
145 Aspen Heating And Cooling
Jackson, MI
Jackson, MI full service residential/commercial HVAC contractor.
Jackson, MI full service residential/commercial HVAC contractor.
146 Mohrhusen & Associates
Menomonee Falls
Menomonee Falls, WI. based residential/commercial plumbing and HVAC contractor.
Plumbing Air Mohrhusen Quality Indoor Conditioning Associates Heating Furnaces Boilers Cooling Commercial Contact Gas Installation Kohler
Menomonee Falls, WI. based residential/commercial plumbing and HVAC contractor.
Plumbing Air Mohrhusen Quality Indoor Conditioning Associates Heating Furnaces Boilers Cooling Commercial Contact Gas Installation Kohler
147 Atlas Butler
Columbus, Ohio
Columbus, Ohio full service commercial/residential HVAC contractor.
Columbus, Ohio full service commercial/residential HVAC contractor.
148 ToolBarn.com, Inc.
Supplier of
Supplier of air, power, cordless and hand tools for the contractor or home improvement market.
Tools Add Price Tool Cart Accessories Power Wishlist Blades Sale Compare Bits Impact Cordless Clearance Lithium Ion Rol Air Order
Supplier of air, power, cordless and hand tools for the contractor or home improvement market.
Tools Add Price Tool Cart Accessories Power Wishlist Blades Sale Compare Bits Impact Cordless Clearance Lithium Ion Rol Air Order
149 AFGO Mechanical Services, Inc.
Full service
Full service commercial air conditioning contractor based in New York.
Full service commercial air conditioning contractor based in New York.
150 Humble Heating & Air Conditioning, Inc.
Full service
Full service West Chicago,IL residential HVAC contractor.
Full service West Chicago,IL residential HVAC contractor.
151 Score Construction
Your experienced
Your experienced wildlife, farm and chainlink fence contractor throughout Western Canada.
Your experienced wildlife, farm and chainlink fence contractor throughout Western Canada.
152 Youngberg Heating & Cooling, L.P.
Payette, ID.
Payette, ID. full service residential/commercial HVAC contractor.
Heating Hvac Air Idaho Conditioning Youngberg Hour Payette Heaing Ontario Guarantee Fruitland Cooling Weiser Consultation
Payette, ID. full service residential/commercial HVAC contractor.
Heating Hvac Air Idaho Conditioning Youngberg Hour Payette Heaing Ontario Guarantee Fruitland Cooling Weiser Consultation
153 Araco Inc.
New England
New England contractor established in 1955 and based in Massachusetts which specializes in trenchless rehabilitation.
New England contractor established in 1955 and based in Massachusetts which specializes in trenchless rehabilitation.
154 Larry and Son Heating and Air Conditioning
Niles MI
Niles MI full service residential / commercial HVAC contractor.
Niles MI full service residential / commercial HVAC contractor.
155 A & M Mechanical Systems, Inc.
Residential and
Residential and commercial full service HVAC contractor based in Stamford, CT.
Boiler Gas Hvac Fairfield Plumbing County Contact Heat Connecticut Residential Commercial Repair Plumbers Heating Conditioning Expertplumbers Cainindustries
Residential and commercial full service HVAC contractor based in Stamford, CT.
Boiler Gas Hvac Fairfield Plumbing County Contact Heat Connecticut Residential Commercial Repair Plumbers Heating Conditioning Expertplumbers Cainindustries
156 AirWise Heating and Air Conditioning, Inc.
Bedford, TX
Bedford, TX residential / commercial full service HVAC contractor.
Bedford, TX residential / commercial full service HVAC contractor.
157 Prahran Air Conditioning
Melbourne, Australia
Melbourne, Australia full service residential/commercial HVAC contractor.
Melbourne, Australia full service residential/commercial HVAC contractor.
158 MMS Industrial Services, LLC
Multi-service contractor
Multi-service contractor specializing in facilities restoration and project management.
Services Information Error Foundinternet Administrative Product Support Help Common Found Tasks Open Setupmessageslinks
Multi-service contractor specializing in facilities restoration and project management.
Services Information Error Foundinternet Administrative Product Support Help Common Found Tasks Open Setupmessageslinks
159 Westside Mechanical, Inc.
HVAC systems
HVAC systems and service contractor serves Chicagoland and the tri-state region.
Systems Hvac Westside Mechanical Airquality Tri Heating National State Chicagolands | Leading Established Inc
HVAC systems and service contractor serves Chicagoland and the tri-state region.
Systems Hvac Westside Mechanical Airquality Tri Heating National State Chicagolands | Leading Established Inc
160 Ace Air Conditioning, Inc.
Full service
Full service residential/commercial HVAC contractor based in central Florida.
Air Conditioning Florida Information Central Equipment Ac Company Services Duct Cleaning Ace Gtmore Specials Contact Customer
Full service residential/commercial HVAC contractor based in central Florida.
Air Conditioning Florida Information Central Equipment Ac Company Services Duct Cleaning Ace Gtmore Specials Contact Customer
161 Ridgeway Heating And Cooling Inc.
Chicago, IL
Chicago, IL full service residential/commercial HVAC contractor.
Chicago, IL full service residential/commercial HVAC contractor.
162 The Airtex Corporation
Florida based
Florida based certified contractor specializing in HVAC duct systems.
Florida based certified contractor specializing in HVAC duct systems.
163 Oregon Cascade Plumbing & Heating, Inc.
Full service
Full service commercial/industrial mechanical contractor.
Full service commercial/industrial mechanical contractor.
164 NavalSupport.com
Connects sailors
Connects sailors and government agencies with contractor support. A Lockheed Martin company.
Connects sailors and government agencies with contractor support. A Lockheed Martin company.
165 Kit Pack Company
Weapons systems
Weapons systems support - U.S. government contractor, Cage Code 30842.
Information Found Services Technical Microsoft Open Support Page Cannot Fileinternet Click
Weapons systems support - U.S. government contractor, Cage Code 30842.
Information Found Services Technical Microsoft Open Support Page Cannot Fileinternet Click
166 CJS Systems
Full service
Full service residential HVAC contractor serving Dayton, Ohio area.
Full service residential HVAC contractor serving Dayton, Ohio area.
167 Desco Professional Builders, Inc
Commercial general
Commercial general contractor specializing in retail store construction.
Commercial general contractor specializing in retail store construction.
168 Enloe Technical Services
Sacramento, CA
Sacramento, CA full service residential - commercial HVAC contractor.
äåðåâüÿ ðàñòåíèÿ Íîâîñòè Êîëîêîëü÷èê äèçàéíà äîáðûå äâóõëåòíèå ñàæàíöû Òèññ Ùèòîëèñòíèê Ìÿò
Sacramento, CA full service residential - commercial HVAC contractor.
äåðåâüÿ ðàñòåíèÿ Íîâîñòè Êîëîêîëü÷èê äèçàéíà äîáðûå äâóõëåòíèå ñàæàíöû Òèññ Ùèòîëèñòíèê Ìÿò
169 Michels Pipeline Construction Inc
General contractor
General contractor with Directional Drilling experience located in Wisconsin.
General contractor with Directional Drilling experience located in Wisconsin.
170 Wolfe Plumbing, Heating, Air Conditioning, Inc.
Montgomery, NY
Montgomery, NY full service residential HVAC contractor.
County Plumbing Heating Conditioning Green_ Green Hudson Services Wolfe Valley Orange Rockland Ulster Dutchess Greene Mid
Montgomery, NY full service residential HVAC contractor.
County Plumbing Heating Conditioning Green_ Green Hudson Services Wolfe Valley Orange Rockland Ulster Dutchess Greene Mid
171 Parrish Sign Company
Nationwide manufacturer
Nationwide manufacturer of real estate and contractor site signage.
Nationwide manufacturer of real estate and contractor site signage.
172 National Contractors
Pre-screened contractor
Pre-screened contractor placement for all facets of commercial and high end residential projects.
Pre-screened contractor placement for all facets of commercial and high end residential projects.
173 Tropical Air Conditioning
Miami, FL.
Miami, FL. based full service commercial/industrial HVAC contractor.
Design Mechanical Construction Tropic Healthcare Maintenance Permanently The Read Team Building | Leed Request Gas Account Commercial
Miami, FL. based full service commercial/industrial HVAC contractor.
Design Mechanical Construction Tropic Healthcare Maintenance Permanently The Read Team Building | Leed Request Gas Account Commercial
174 Carrano Air Contracting, Inc.
Full service
Full service residential/commercial HVAC contractor based in Dayton, NJ.
Heating Conditioning Aircontracting Carrano Air Services County Residential Commercial Contractor Repair Maintenance Hvac Brunswick Efficiency Safety Berkeley Contractors Certified
Full service residential/commercial HVAC contractor based in Dayton, NJ.
Heating Conditioning Aircontracting Carrano Air Services County Residential Commercial Contractor Repair Maintenance Hvac Brunswick Efficiency Safety Berkeley Contractors Certified
175 Design Comfort Inc.
Full service
Full service commercial/industrial HVAC contractor based in Howell, MI.
Full service commercial/industrial HVAC contractor based in Howell, MI.
176 Parksons Engineering Co. PVT. LTD.
Commercial HVAC
Commercial HVAC and refrigeration contractor offering design and manufacturing capability.
Commercial HVAC and refrigeration contractor offering design and manufacturing capability.
177 Cornerstone Air Conditioning Inc.
Full service
Full service residential / commercial HVAC contractor based in Honolulu, HI.
Full service residential / commercial HVAC contractor based in Honolulu, HI.
178 Bear Mechanical Services, LLC
Lexington, SC
Lexington, SC full service commercial/industrial HVAC contractor.
Hvac Bear Mechanical Carolina South Sc Services Air Heating Commercial Industrial Bms Llc Providing Systems Operate
Lexington, SC full service commercial/industrial HVAC contractor.
Hvac Bear Mechanical Carolina South Sc Services Air Heating Commercial Industrial Bms Llc Providing Systems Operate
179 Brian and Sons, Inc.
Residential and
Residential and light commercial HVAC contractor serving Fox Valley and the Chicagoland area.
Residential and light commercial HVAC contractor serving Fox Valley and the Chicagoland area.
180 Mid-State Mechanical
Rocky Hill
Rocky Hill, CT industrial, commercial and residential full service HVAC contractor.
Rocky Hill, CT industrial, commercial and residential full service HVAC contractor.
181 Building Facility Solutions
Full service
Full service Minneapolis/St.Paul,residential/commercial HVAC contractor.
Z Y
Full service Minneapolis/St.Paul,residential/commercial HVAC contractor.
Z Y
182 Contractors Choice Inc
Sells, rents
Sells, rents and leases tools and equipment for the general, electrical and mechanical contractor.
Sells, rents and leases tools and equipment for the general, electrical and mechanical contractor.
183 Northern Air Corporation
Full service
Full service commercial, institutional, and industrial HVAC contractor based in Little Canada, MN.
Hvac Electrical Mechanical Construction Automation Services Contractors Projects Designestimation Safety Employment Contact Minnesota Systems Legal Center
Full service commercial, institutional, and industrial HVAC contractor based in Little Canada, MN.
Hvac Electrical Mechanical Construction Automation Services Contractors Projects Designestimation Safety Employment Contact Minnesota Systems Legal Center
184 Patterson Heating & Air Conditioning
Charlotte, NC.
Charlotte, NC. based residential/commercial full service HVAC contractor.
Charlotte, NC. based residential/commercial full service HVAC contractor.
185 Comfort Maintenance Heating And Airconditiong Services
Kansas City
Kansas City, MO residential/commercial HVAC contractor.
Kansas City, MO residential/commercial HVAC contractor.
186 Adkins Air Conditioning and Heating, Inc.
Kennesaw, GA.
Kennesaw, GA. based full service residential / commercial HVAC contractor.
Kennesaw, GA. based full service residential / commercial HVAC contractor.
187 LJM Air Conditioning
Full service
Full service residential/comercial HVAC contractor serving the Phoenix metro area.
Phoenix Lifetime Conditioning Free Repair Hvac Air Technicians Members Guarantee Club Services Ac Warranty Worry Contact Products
Full service residential/comercial HVAC contractor serving the Phoenix metro area.
Phoenix Lifetime Conditioning Free Repair Hvac Air Technicians Members Guarantee Club Services Ac Warranty Worry Contact Products
188 Teds Heating and Air Conditioning
Fort Smith
Fort Smith, AR full service residential/commercial HVAC contractor.
Elementary Teds Technology Hvac Today Fairview Fort Refrigeration Now Heating Teds Inc License Sgf Scott Commonlycalled
Fort Smith, AR full service residential/commercial HVAC contractor.
Elementary Teds Technology Hvac Today Fairview Fort Refrigeration Now Heating Teds Inc License Sgf Scott Commonlycalled
189 Airsurance Heating and Air Conditioning
Montgomery, Alabama
Montgomery, Alabama full service residential/commercial HVAC contractor.
Montgomery, Alabama full service residential/commercial HVAC contractor.
190 MJ Flaherty Company
HVAC and
HVAC and mechanical contractor serving industrial and commercial accounts throughout Boston and New England.
Z Y
HVAC and mechanical contractor serving industrial and commercial accounts throughout Boston and New England.
Z Y
191 Battles, Brian
Microsoft Certified
Microsoft Certified Professional Visual Basic/MS Access/SQL programmer (W2 contractor) available in Connecticut.
Radio Former Battles Amateur Microsoft Web Consultant Brian Access Contractor Programmer Consulting Vb Basic Visual Emergency Contracting Updated
Microsoft Certified Professional Visual Basic/MS Access/SQL programmer (W2 contractor) available in Connecticut.
Radio Former Battles Amateur Microsoft Web Consultant Brian Access Contractor Programmer Consulting Vb Basic Visual Emergency Contracting Updated
192 Custom Comfort Systems
Loves Park
Loves Park, IL full service residential/commercial HVAC contractor.
Loves Park, IL full service residential/commercial HVAC contractor.
193 Gauge Heating & Air Conditioning Ltd.
Burnaby, BC
Burnaby, BC residential and light commercial full service HVAC contractor.
Burnaby, BC residential and light commercial full service HVAC contractor.
194 All Seasons Heating and Cooling
Full service
Full service residential and commercial HVAC contractor based in Louisville, Ky.
Heating Cooling Season Louisville Air Heat Brands License Services Page Furnaces Seasons Company Conditioning Number Goodman York Rights Fax Offering
Full service residential and commercial HVAC contractor based in Louisville, Ky.
Heating Cooling Season Louisville Air Heat Brands License Services Page Furnaces Seasons Company Conditioning Number Goodman York Rights Fax Offering
195 Midwesco Services, Inc.
Mechanical and
Mechanical and Electrical Contractor for Business, Industry and Institutions in Greater Chicago area.
Mechanical and Electrical Contractor for Business, Industry and Institutions in Greater Chicago area.
196 FlightSafety Services Corporation
Training systems
Training systems, management and integration, and government contractor logistics support.
International Defenseflightsafety| Military Government Inc
Training systems, management and integration, and government contractor logistics support.
International Defenseflightsafety| Military Government Inc
197 Radiola Aerospace Limited
Engineering contractor
Engineering contractor and integrated logistic support for defense and aviation customers.
Flight Inspection Radiola Aerospace Services Validation Worldwide Systems Navigation Airfield Printer Friendly Lighting Articles Awards Calibration Press Locations
Engineering contractor and integrated logistic support for defense and aviation customers.
Flight Inspection Radiola Aerospace Services Validation Worldwide Systems Navigation Airfield Printer Friendly Lighting Articles Awards Calibration Press Locations
198 Jim Kerns Heating and Cooling
Full service
Full service residential HVAC contractor serving the Boston, MA. area.
Full service residential HVAC contractor serving the Boston, MA. area.
199 fourman industries, inc.
offers custom
offers custom printed, contractor-grade extension cords in several colors and lengths.
offers custom printed, contractor-grade extension cords in several colors and lengths.
200 Ceta
Mechanical and
Mechanical and electrical engineering services contractor building turn-key facilities for the cement industry.
Mechanical and electrical engineering services contractor building turn-key facilities for the cement industry.
2. Shopping and Contractor Trade
1 A Womans Guide to Hiring a Contractor
A womans
A womans guide to hiring a contractor, company or any service provider.
Z Y
A womans guide to hiring a contractor, company or any service provider.
Z Y
2 Build Home
Guide to
Guide to being the general contractor.
House Technology Concrete Gallery Share Residential Build Design Home _建 Better Us Jkying@gmailcom Locationtoppxleftpxz Okinawa Buildingindexheightpxwidthpxbackgroundtransparentbordernone *
Guide to being the general contractor.
House Technology Concrete Gallery Share Residential Build Design Home _建 Better Us Jkying@gmailcom Locationtoppxleftpxz Okinawa Buildingindexheightpxwidthpxbackgroundtransparentbordernone *
3 Homeimprovementinfo.com
Sells a
Sells a guide that provides advice on how to choose a contractor.
Improvement Home Leading Homeimprovementinfocom Ityourself Remodel Homeimprovement Ideas Materials Bathroom Remodeling Jointhousands Netcontractor
Sells a guide that provides advice on how to choose a contractor.
Improvement Home Leading Homeimprovementinfocom Ityourself Remodel Homeimprovement Ideas Materials Bathroom Remodeling Jointhousands Netcontractor
4 Harmony Grove, Inc.
Providing bamboo
Providing bamboo floors. Installation available by licensed contractor.
Ñèñòåìû äèïëîì îõðàíû íà Êóïèòü Request çàùèòû äëÿ Harmonygroveflooringcom îáðàçîâàíèè î âèäåîíàáëþäåíèÿ äîñòóïà Ïîæàðíî
Providing bamboo floors. Installation available by licensed contractor.
Ñèñòåìû äèïëîì îõðàíû íà Êóïèòü Request çàùèòû äëÿ Harmonygroveflooringcom îáðàçîâàíèè î âèäåîíàáëþäåíèÿ äîñòóïà Ïîæàðíî
5 Golfscape Designs
About synthetic
About synthetic greens for putting, the contractor, and photo gallery.
Navigationshilfet Y
About synthetic greens for putting, the contractor, and photo gallery.
Navigationshilfet Y
6 The Western New York Floor Co., Inc.
Consultant and
Consultant and contractor for athletic flooring. Provides news, FAQ, and map of territory.
Blog Portfolio Floors Full Styles Width Layout Floor Example York Project Western Company Slider University Alternate Gallery Robbins
Consultant and contractor for athletic flooring. Provides news, FAQ, and map of territory.
Blog Portfolio Floors Full Styles Width Layout Floor Example York Project Western Company Slider University Alternate Gallery Robbins
7 Mildman
Featuring concrete
Featuring concrete contractor tools. [Best Viewed on IE, doesnt work in all browsers.]
Tripod Create Requested Lycoscom Please Hosting Check Login Website Page Couldnttripodcom Signup Shopping
Featuring concrete contractor tools. [Best Viewed on IE, doesnt work in all browsers.]
Tripod Create Requested Lycoscom Please Hosting Check Login Website Page Couldnttripodcom Signup Shopping
8 PondScapeDesigns.com
Authorized contractor
Authorized contractor and retailer of Aquascape Designs garden pond supplies.
Z Y
Authorized contractor and retailer of Aquascape Designs garden pond supplies.
Z Y
9 The Western New York Floor Co., Inc.
Consultant and
Consultant and contractor for athletic flooring. Provides news, FAQ, and map of territory.
Z Y
Consultant and contractor for athletic flooring. Provides news, FAQ, and map of territory.
Z Y
10 R.E. Williams Contractor Inc.
Sells whole
Sells whole house exhaust fans. Discusses sizing, provides testimonials and installation instructions.
House Whole Fans Fan How Requirements Roof Cool Attic Size Policy Blog Properly Found Quietcool Privacy Port
Sells whole house exhaust fans. Discusses sizing, provides testimonials and installation instructions.
House Whole Fans Fan How Requirements Roof Cool Attic Size Policy Blog Properly Found Quietcool Privacy Port
11 Steve Austin Painting
Learn faux
Learn faux finishing from a California artisan, contractor, and instructor with over 20 years of experience.
Providerfor Contactdisplayederror Page Please Cannot
Learn faux finishing from a California artisan, contractor, and instructor with over 20 years of experience.
Providerfor Contactdisplayederror Page Please Cannot
12 Westfire Manufacturing, Inc.
Manufacturer of
Manufacturer of fireplace mantels, mantel surrounds, stairs and stair parts for the homebuilder and contractor.
Balusters Newel Handrail Stair Posts Iron Series Box Collection Round Newels Colonial Post Steel Hampton Flat
Manufacturer of fireplace mantels, mantel surrounds, stairs and stair parts for the homebuilder and contractor.
Balusters Newel Handrail Stair Posts Iron Series Box Collection Round Newels Colonial Post Steel Hampton Flat
13 Clever Kid Designs
Offering aprons
Offering aprons and bibs with pockets in many styles including baker, crafter, gardener and contractor.
Clever Kid Aprons Childrens Play Child Apron Art Kids Themed School Kitchen Designs Schedule Preschool Artistic Preschoolers Teacher
Offering aprons and bibs with pockets in many styles including baker, crafter, gardener and contractor.
Clever Kid Aprons Childrens Play Child Apron Art Kids Themed School Kitchen Designs Schedule Preschool Artistic Preschoolers Teacher
14 Infra-Red Products
Sells garage
Sells garage, portable, outdoor, and construction heaters, as well as furnaces and fireplaces. Provides contractor, FAQ, and news pages.
Heaters Infrared Shop Patio Heat Outdoor How Radiant Heater Garage Construction Review Wall Superior Tube Habanero
Sells garage, portable, outdoor, and construction heaters, as well as furnaces and fireplaces. Provides contractor, FAQ, and news pages.
Heaters Infrared Shop Patio Heat Outdoor How Radiant Heater Garage Construction Review Wall Superior Tube Habanero
15 Miller Bros. Paint & Decorating Stores - Online
Offers materials
Offers materials for both the do-it-yourselfer and the full service painting contractor.
Plesk Parallels Default Containers Panel Control Page Using Reserved Copy Discovervirtuozzo Parallelsvirtuozzo Server
Offers materials for both the do-it-yourselfer and the full service painting contractor.
Plesk Parallels Default Containers Panel Control Page Using Reserved Copy Discovervirtuozzo Parallelsvirtuozzo Server
16 Vehicle Accessories
Offers aftermarket
Offers aftermarket products including nerf bars, truck caps and Truxedo tonneau covers. Features a contractor section.
Truck Liner Accessories Liners Vehicle Industries Covers Cover Suspension Directions Racks Products Ladder Tailgate Caps Monday Friday Draw Tite Fold Sno Way
Offers aftermarket products including nerf bars, truck caps and Truxedo tonneau covers. Features a contractor section.
Truck Liner Accessories Liners Vehicle Industries Covers Cover Suspension Directions Racks Products Ladder Tailgate Caps Monday Friday Draw Tite Fold Sno Way
17 Contractor Books
Reference books
Reference books, plus videos, software and study guides for the construction industry.
Books Codes Construction Electrical Building Cost Tools Contractor Code How Means Meters Estimator Bookscom Plumbing
Reference books, plus videos, software and study guides for the construction industry.
Books Codes Construction Electrical Building Cost Tools Contractor Code How Means Meters Estimator Bookscom Plumbing
18 Lighting Valley
Sells recessed
Sells recessed, track, outdoor, and landscape lighting. Provides contractor and government sections.
Sells recessed, track, outdoor, and landscape lighting. Provides contractor and government sections.
19 Contractorbargains.com
Specialize in
Specialize in merchandise for the contractor or do-it-yourselfer including tools, home and garden items, heaters, fans and construction safety items.
Heaters Safety Event Tools Parts Electrical Propane Batteries Protection Misc Industrial Plumbing Contact Accessories Patio Concession Lights Evaporative Hearing
Specialize in merchandise for the contractor or do-it-yourselfer including tools, home and garden items, heaters, fans and construction safety items.
Heaters Safety Event Tools Parts Electrical Propane Batteries Protection Misc Industrial Plumbing Contact Accessories Patio Concession Lights Evaporative Hearing
20 Deck USA
Deck plans
Deck plans and designs. CD-rom, contractor referral, deck software.
Deck Plans Decks Designs Shed Design Software Patio Rom Plan Cd Custom Information Usa Free Deckbrackets Square
Deck plans and designs. CD-rom, contractor referral, deck software.
Deck Plans Decks Designs Shed Design Software Patio Rom Plan Cd Custom Information Usa Free Deckbrackets Square
21 Accessibility Lifts
Wheelchair lift
Wheelchair lift accessibility contractor in South Florida. Specializes in commercial and residential lifts.
Free Page Construction Accessibilityliftscom Luxury Policy Tickets Credit Zone Smart Trademark Phones Insurance Review Rates High Migraine
Wheelchair lift accessibility contractor in South Florida. Specializes in commercial and residential lifts.
Free Page Construction Accessibilityliftscom Luxury Policy Tickets Credit Zone Smart Trademark Phones Insurance Review Rates High Migraine
22 PF Pros
Pond and
Pond and fountain equipment and supplies. Information and diagrams for the contractor, architect, or experienced do-it yourselfer to help design, build, maintain, and troubleshoot a pond or fountain.
Fountain Supply Pond Water Garden Fountains Indoor Outdoor Supplies Equipment Sand Filter Pros Waterfall Pump
Pond and fountain equipment and supplies. Information and diagrams for the contractor, architect, or experienced do-it yourselfer to help design, build, maintain, and troubleshoot a pond or fountain.
Fountain Supply Pond Water Garden Fountains Indoor Outdoor Supplies Equipment Sand Filter Pros Waterfall Pump
23 Lineberry Tennis
Tennis court
Tennis court contractor that offers hard and soft court resurfacing and construction. Fencing, lighting installation, and tennis accessories are also offered.
Lineberry Click Tennis Profiles Project Installations Surface Sign Services Contact Here Faqs Surfaces Court Store
Tennis court contractor that offers hard and soft court resurfacing and construction. Fencing, lighting installation, and tennis accessories are also offered.
Lineberry Click Tennis Profiles Project Installations Surface Sign Services Contact Here Faqs Surfaces Court Store
3. Contractor Recreation
1 LAR, Ltd. (UK)
Asbestos removal
Asbestos removal contractor, located in Stockport.
Policy Manchester Office Contact Town Park Recently Accreditations Crossley Welcome Company Email Personnel Fax Services Halllibrary Healthand
Asbestos removal contractor, located in Stockport.
Policy Manchester Office Contact Town Park Recently Accreditations Crossley Welcome Company Email Personnel Fax Services Halllibrary Healthand
2 Greenspoon Bros. Limited
Asbestos abatement
Asbestos abatement and demolition contractor in Ontario, Canada.
Create Tripod Hostinglycoscom Website Requested Lycos Page Tripodcom Signuplogin Shopping Check
Asbestos abatement and demolition contractor in Ontario, Canada.
Create Tripod Hostinglycoscom Website Requested Lycos Page Tripodcom Signuplogin Shopping Check
3 Watkins Contracting, Inc.
San Diego
San Diego based construction management and environmental clean-up contractor.
Contracting Watkins Inc Copyrightincwatkinsrightsreserved Inc‚ÉÃ…Â Ö‚·Ã¢â‚¬Å¡éÂÂî•ñ Inc‚»Ã¢â‚¬Å¡Ì‘¼Ã… ÖËœaÂÂî•ñ
San Diego based construction management and environmental clean-up contractor.
Contracting Watkins Inc Copyrightincwatkinsrightsreserved Inc‚ÉÃ…Â Ö‚·Ã¢â‚¬Å¡éÂÂî•ñ Inc‚»Ã¢â‚¬Å¡Ì‘¼Ã… ÖËœaÂÂî•ñ
4 Bad Company Rodeo
Contractor for
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Here Bull Click Bad Contact Learn News Genetics Texas Little Expect Bulls Mixed Finals Riding
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Here Bull Click Bad Contact Learn News Genetics Texas Little Expect Bulls Mixed Finals Riding
5 Bad Company Rodeo
Contractor for
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Here Bull Click Contact Bad Unexpected Learn Prca News Schedule Hammer Finals Way Deer Nationalfinals
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Here Bull Click Contact Bad Unexpected Learn Prca News Schedule Hammer Finals Way Deer Nationalfinals
6 Toy Trucker & Contractor
Offers monthly
Offers monthly publication for collectors. Includes sales, shows, and subscription information.
Offers monthly publication for collectors. Includes sales, shows, and subscription information.
7 Bad Company Rodeo
Includes contractor
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Here Bull Click Bad Contact Unexpected National News Gallery Finals Hammer Inc Schedule Bucking Awesome
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Here Bull Click Bad Contact Unexpected National News Gallery Finals Hammer Inc Schedule Bucking Awesome
8 Bad Company Rodeo
Includes contractor
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Here Bull Click Contact Bad Inc Wrangler Unexpected Texas Stock Bulls West Wild Tour
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Here Bull Click Contact Bad Inc Wrangler Unexpected Texas Stock Bulls West Wild Tour
9 A Q Environmental
Full service
Full service environmental contractor in Los Angeles, performing asbestos removal and other services.
Mold Cleanup Rental Damage Removal Water Asbestos Air Restoration Equipment Abatement Dehumidifier Lead Carpet Testing Control Hepa Referencess
Full service environmental contractor in Los Angeles, performing asbestos removal and other services.
Mold Cleanup Rental Damage Removal Water Asbestos Air Restoration Equipment Abatement Dehumidifier Lead Carpet Testing Control Hepa Referencess
10 Flying U Rodeo Co.
Californias stock
Californias stock contractor. Information on professional rodeo production and the original 'Born to Buck' program.
Bucking Horses Bulls Rodeos Flying Horses_rodeos Rodeo Bulls_bucking Performance Sale Nfrpbr Award Striving Winning Heifers
Californias stock contractor. Information on professional rodeo production and the original 'Born to Buck' program.
Bucking Horses Bulls Rodeos Flying Horses_rodeos Rodeo Bulls_bucking Performance Sale Nfrpbr Award Striving Winning Heifers
11 California Skateparks
General contractor
General contractor for concrete skateparks. Includes references, company profile, resume, and contact information.
Wally Hollyday Skateparks Skate Park Atlanta Open Designbuild Laurel Click Here Wally@skatedesigncom Tour Approach Phase Settles Designed
General contractor for concrete skateparks. Includes references, company profile, resume, and contact information.
Wally Hollyday Skateparks Skate Park Atlanta Open Designbuild Laurel Click Here Wally@skatedesigncom Tour Approach Phase Settles Designed
12 Cooper Radiology Contracting, Inc
Radiologist offering
Radiologist offering USA nationwide services as an independent contractor to help healthcare facilities with short term staffing shortages in diagnostic radiology.
Navigationshilfe Ty
Radiologist offering USA nationwide services as an independent contractor to help healthcare facilities with short term staffing shortages in diagnostic radiology.
Navigationshilfe Ty
13 A-1 Miniature Golf Design and Construction
Contractor profile
Contractor profile and information on services and projects building miniature golf courses.
Z Y
Contractor profile and information on services and projects building miniature golf courses.
Z Y
14 Contractor City Construction Jokes
Construction and
Construction and building trades-related jokes and humor.
Z Y
Construction and building trades-related jokes and humor.
Z Y
15 The New England Laborers Health and Safety Fund
A joint
A joint labor-management organization that works with the union and the contractor for the benefit of union members and signatory contractors through a more safety conscious and productive workforce.
Winter Laborers Smoking Type Health Nelhsf Storms England Year’s Homepage Chantix Storm Cessation Set Resolution Keep Loss Heavy Gloves
A joint labor-management organization that works with the union and the contractor for the benefit of union members and signatory contractors through a more safety conscious and productive workforce.
Winter Laborers Smoking Type Health Nelhsf Storms England Year’s Homepage Chantix Storm Cessation Set Resolution Keep Loss Heavy Gloves
16 Environmental Health Resources, Inc.
Health and
Health and safety consulting and programs, indoor air quality, industrial hygiene, asbestos management, lead, environmental health, OSHA, contractor supervisor training, asbestos worker training. (MI)
Ehr Ehrinccom Advancedmd Falcon Behr Target Section Legal Here Systems Bestterms Learn Browse
Health and safety consulting and programs, indoor air quality, industrial hygiene, asbestos management, lead, environmental health, OSHA, contractor supervisor training, asbestos worker training. (MI)
Ehr Ehrinccom Advancedmd Falcon Behr Target Section Legal Here Systems Bestterms Learn Browse
4. Computer & Contractor Games Websites
1 ACT Contractors Forms
Construction form
Construction form software, California contractor forms, other states, general contractor forms, roofing, painting, other trades. Contractor legal forms and contractor business forms.
Forms Contractor Form Contractors Construction Software Other Help Print Roofing General Laws State Contractorforms Need
Construction form software, California contractor forms, other states, general contractor forms, roofing, painting, other trades. Contractor legal forms and contractor business forms.
Forms Contractor Form Contractors Construction Software Other Help Print Roofing General Laws State Contractorforms Need
2 Contractor Software Corporation
Accounting and
Accounting and job costing software for the construction industry, including Contractor V. Software demo, dealer opportunities, and contacts.
Software Accounting Contractor Construction General Job Project Electrical Commercial Advisor Payroll Repair Specialty Government Insurance Products Technology
Accounting and job costing software for the construction industry, including Contractor V. Software demo, dealer opportunities, and contacts.
Software Accounting Contractor Construction General Job Project Electrical Commercial Advisor Payroll Repair Specialty Government Insurance Products Technology
3 ConTracker E Z - Contractor Estimating Software
General contractor
General contractor business estimating software for roofing, siding and all construction uses.
Injury Accident Personal Laura Soltis Rss Cases Dog Injuries Auto Bites Claims Bit Brain Tampa Johnbalescom
General contractor business estimating software for roofing, siding and all construction uses.
Injury Accident Personal Laura Soltis Rss Cases Dog Injuries Auto Bites Claims Bit Brain Tampa Johnbalescom
4 Maverick Communications, Inc.
Telecommunications contractor
Telecommunications contractor servicing Texas and southwest Louisiana.
Maverick Company Systems Partners Contact Inc Cabling Quote Structured Alarms Telephone Employment Services Burglar Security Profile
Telecommunications contractor servicing Texas and southwest Louisiana.
Maverick Company Systems Partners Contact Inc Cabling Quote Structured Alarms Telephone Employment Services Burglar Security Profile
5 The American Contractor
Offering a
Offering a construction accounting and management software package for Windows.
Management Maxwell Software Systems Project Equipment Gt Construction Success System Privacy Financial Demo Modules Take
Offering a construction accounting and management software package for Windows.
Management Maxwell Software Systems Project Equipment Gt Construction Success System Privacy Financial Demo Modules Take
6 Jeff Tapper
Independent contractor
Independent contractor and certified instructor covers ColdFusion, Flash, and Flex.
Navigationshilfey
Independent contractor and certified instructor covers ColdFusion, Flash, and Flex.
Navigationshilfey
7 Peabody NC Programming Corporation
An independent
An independent SurfCAM contractor, offering to write programs for all CNC hardware.
Z Y
An independent SurfCAM contractor, offering to write programs for all CNC hardware.
Z Y
8 Richard A. DeVenezia
I am
I am an independent contractor that can help you turn raw data into information that is delivered to your internal or external customers.
Nesug Sesug Sugi Using Sasr Windows Tournament Sas Richard Contact Generator Storing Perl Round Geometry Topic Sasafr Strip Javaobj
I am an independent contractor that can help you turn raw data into information that is delivered to your internal or external customers.
Nesug Sesug Sugi Using Sasr Windows Tournament Sas Richard Contact Generator Storing Perl Round Geometry Topic Sasafr Strip Javaobj
9 Brown, Martin G.
A log
A log of issues faced by a .Net contractor, and the resolutions he used. There is a mixture of C# and VB.Net. It also contains items seen by the author as interesting to .Net developers.
Plesk Mgblog Code Developers Dump London Group Net Hosting Vbnet Parallels Source Regexeditor Domain Learn Converting Itdownloads Sourcesafe Microsoft
A log of issues faced by a .Net contractor, and the resolutions he used. There is a mixture of C# and VB.Net. It also contains items seen by the author as interesting to .Net developers.
Plesk Mgblog Code Developers Dump London Group Net Hosting Vbnet Parallels Source Regexeditor Domain Learn Converting Itdownloads Sourcesafe Microsoft
10 Clear Solutions
Resellers of
Resellers of Intuit Master Builder and Quickbooks Contractor Edition offer consulting for the construction industry.
Z Y
Resellers of Intuit Master Builder and Quickbooks Contractor Edition offer consulting for the construction industry.
Z Y
11 CSCI Software Systems
Contractor billing
Contractor billing automatically on AIA documents G701, G702, G703, G701Cma, G702Cma. For Windows 2000, NT, 98, 95 on CD ROM.
Software Billing Contractor Document Construction Aia Documents Gcma Click Invoice Csci Here Windows Cbsnet Order
Contractor billing automatically on AIA documents G701, G702, G703, G701Cma, G702Cma. For Windows 2000, NT, 98, 95 on CD ROM.
Software Billing Contractor Document Construction Aia Documents Gcma Click Invoice Csci Here Windows Cbsnet Order
12 Embedded Technologies
Software/hardware development
Software/hardware development contractor. We specialize in Windows programming in Visual Basic. Based in Owasso, Oklahoma.
Software Visual Basic Vbsizer Activex Windows Embedded Technologies Computer Using Automatic Control Form Resizing Programming Homeof
Software/hardware development contractor. We specialize in Windows programming in Visual Basic. Based in Owasso, Oklahoma.
Software Visual Basic Vbsizer Activex Windows Embedded Technologies Computer Using Automatic Control Form Resizing Programming Homeof
13 SDS Command Post 3000
Offers business
Offers business management software for the contractor and service industry. Includes screenshots and demo request.
Software Dispatch Contracting Command Post Systems System Management Business Dispatching Ultimate Computer Requirements Metal Accounts Productive Parts Reserved
Offers business management software for the contractor and service industry. Includes screenshots and demo request.
Software Dispatch Contracting Command Post Systems System Management Business Dispatching Ultimate Computer Requirements Metal Accounts Productive Parts Reserved
14 Testing Circle Ltd.
Contractor placement
Contractor placement business specializing in software testing.
Jobs Testing Courses Mobile Software Circle Academy Partners Consultancy Recruitment Events Network Circles Managers
Contractor placement business specializing in software testing.
Jobs Testing Courses Mobile Software Circle Academy Partners Consultancy Recruitment Events Network Circles Managers
15 Builders Software
Residential construction
Residential construction software for contractor or owner builder.
Software Construction Contractor Weather Print Business Adobe Severe Acrobat Products Recovery Restoration Trade Homeowner Suite Planners Schedule
Residential construction software for contractor or owner builder.
Software Construction Contractor Weather Print Business Adobe Severe Acrobat Products Recovery Restoration Trade Homeowner Suite Planners Schedule
16 Websites4Contractors
Offers design
Offers design and marketing services for contractors and contractor services.
Contractors Contractor Construction Web General Sites Websites Directory Remodeling Resources Services Concrete Abatement Website Siding
Offers design and marketing services for contractors and contractor services.
Contractors Contractor Construction Web General Sites Websites Directory Remodeling Resources Services Concrete Abatement Website Siding
17 Contractor Software
Construction forms
Construction forms and agreements on fill-in software.
Answers General Order Contracts Forms Samples Notice Expertly Construction Testimonials Lien Articles Tile Agreement Mechanics Conditional Painting
Construction forms and agreements on fill-in software.
Answers General Order Contracts Forms Samples Notice Expertly Construction Testimonials Lien Articles Tile Agreement Mechanics Conditional Painting
18 Saunders Contracting Services
Full service
Full service communications installer to include voice, data, and fiber optic systems. Also a state licensed electrical contractor.
Electrical Contractor Services Industrial Telecommunicationshomeserviceshistorycontact Virgina Electric Contracting Hampton Historyincelectrical Commercial Saunders Va
Full service communications installer to include voice, data, and fiber optic systems. Also a state licensed electrical contractor.
Electrical Contractor Services Industrial Telecommunicationshomeserviceshistorycontact Virgina Electric Contracting Hampton Historyincelectrical Commercial Saunders Va
19 PrioSoft
Priority One
Priority One Plus business software for the construction, contractor, handyman, and automobile dealer industries. Includes contact management, accounting, and other features specific for each industry.
Software Construction Estimating Office Priosoft Cost Contractors Contractor’s Project Partners Management Support Free Scheduling Contact Mission Priosoft’s Virtual Whether
Priority One Plus business software for the construction, contractor, handyman, and automobile dealer industries. Includes contact management, accounting, and other features specific for each industry.
Software Construction Estimating Office Priosoft Cost Contractors Contractor’s Project Partners Management Support Free Scheduling Contact Mission Priosoft’s Virtual Whether
20 PrioSoft
Makers of
Makers of Priority One Plus business software for the construction, contractor, handyman, and automobile dealer industries. Includes contact management, accounting, and other features specific for each industry.
Construction Software Estimating Office Priosoft Cost Contractors Contractor’s Project Partners Support Management Create Scheduling Cloud Estimates Trial Dc Commercial
Makers of Priority One Plus business software for the construction, contractor, handyman, and automobile dealer industries. Includes contact management, accounting, and other features specific for each industry.
Construction Software Estimating Office Priosoft Cost Contractors Contractor’s Project Partners Support Management Create Scheduling Cloud Estimates Trial Dc Commercial
21 Team Management Systems
HVAC, Plumbing
HVAC, Plumbing, Electrical software designed for the contractor. Product information, meet the team, credentials, training and support.
Management Team Systems Acomarc Windows Acowin Acotruck Software Learn Acorate Project Flat Rate Mobile Work Pro Ldquobest Unix
HVAC, Plumbing, Electrical software designed for the contractor. Product information, meet the team, credentials, training and support.
Management Team Systems Acomarc Windows Acowin Acotruck Software Learn Acorate Project Flat Rate Mobile Work Pro Ldquobest Unix
22 American Contractor
Construction estimating
Construction estimating software for bidding and cost control. Training included with every system. Flexible job cost tracking, accounting and service dispatch packages.
Estate Real Amer Leading Amerconcom Net Con Advice Brokers Insuranceagents Propertymanagement Mortgages Join
Construction estimating software for bidding and cost control. Training included with every system. Flexible job cost tracking, accounting and service dispatch packages.
Estate Real Amer Leading Amerconcom Net Con Advice Brokers Insuranceagents Propertymanagement Mortgages Join
23 Contractor V
Powerful accounting
Powerful accounting and job costing software with features allowing contractors to control cost and eliminate waste specifically designed for the Construction industry and flexible for all types of contractors.
Company Recetas Financial Corp Stock Investors Soft Reports Investor Mobilya Privacy Investment Listings Finance Sponsored Plus™ Demokonto Annual Related
Powerful accounting and job costing software with features allowing contractors to control cost and eliminate waste specifically designed for the Construction industry and flexible for all types of contractors.
Company Recetas Financial Corp Stock Investors Soft Reports Investor Mobilya Privacy Investment Listings Finance Sponsored Plus™ Demokonto Annual Related
24 Contractor Anywhere, Inc.
Enterprise construction
Enterprise construction management and service management dispatch software for general, service, specialty, and residential contractors.
Legacy Sage Nexuswebcd Sage Z
Enterprise construction management and service management dispatch software for general, service, specialty, and residential contractors.
Legacy Sage Nexuswebcd Sage Z
25 Jacquinot Consulting, Inc.
Smart Card
Smart Card consulting in Atlanta, GA, USA: contractor for software development and project management. Specialized in security chips, smart cards, security tokens and dongles via PC/SC, ISO 7816 standards.
Smart Card Development Software Consulting Contact Services Customization Cards Evaluation Jacquinot Atlanta Security Technical System Biometrics Multos Consultancy
Smart Card consulting in Atlanta, GA, USA: contractor for software development and project management. Specialized in security chips, smart cards, security tokens and dongles via PC/SC, ISO 7816 standards.
Smart Card Development Software Consulting Contact Services Customization Cards Evaluation Jacquinot Atlanta Security Technical System Biometrics Multos Consultancy
26 Profitool Inc.
Comprehensive construction
Comprehensive construction accounting and job cost software for the large contractor. Clients range from heavy/highway to large specialty and general contractors. Includes dispatching, human resources, general ledger, equipment, billing, report writer, GUI interface.
Contact Request News Map Profitool Login Constructionsoftware Clientaccounting
Comprehensive construction accounting and job cost software for the large contractor. Clients range from heavy/highway to large specialty and general contractors. Includes dispatching, human resources, general ledger, equipment, billing, report writer, GUI interface.
Contact Request News Map Profitool Login Constructionsoftware Clientaccounting
1 Aktion Enterprises
Painting Contractor
Painting Contractor with a knack for painting miniatures and building terrain. Website contains photo galleries of work and contact information.
Navigationshilfe Ty
Painting Contractor with a knack for painting miniatures and building terrain. Website contains photo galleries of work and contact information.
Navigationshilfe Ty
2 Harry Macks Video Game Music
Contractor available
Contractor available for work. Download samples of Harry Macks Video Games Music
Sound Game Music Audio Apache Casual Rpg Indie Ipad Mack Server Effects Contractharry
Contractor available for work. Download samples of Harry Macks Video Games Music
Sound Game Music Audio Apache Casual Rpg Indie Ipad Mack Server Effects Contractharry
5. Sports Websites concerning Contractor
1 Bad Company Rodeo
Contractor for
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Bull Contact Bad Here Schedule West Gallery Unexpected Inc Genetics Stock Expect Little Tour George
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Bull Contact Bad Here Schedule West Gallery Unexpected Inc Genetics Stock Expect Little Tour George
2 Bad Company Rodeo
Contractor for
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Contact Bull Bad Here Genetics Bulls Unexpected Stock Mixed Inc Wild Production Expect George
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Contact Bull Bad Here Genetics Bulls Unexpected Stock Mixed Inc Wild Production Expect George
3 Bad Company Rodeo
Includes contractor
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Contact Bad Bull Here Stock Schedule West Little Expect Mixed News Tour Prca Contractor National
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Contact Bad Bull Here Stock Schedule West Little Expect Mixed News Tour Prca Contractor National
4 Bad Company Rodeo
Includes contractor
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Bad Bull Contact Here Tour Stock Expect Mixed Little Wild Inc Production News Bulls Altizer
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Bad Bull Contact Here Tour Stock Expect Mixed Little Wild Inc Production News Bulls Altizer
5 Flying U Rodeo Co.
Californias stock
Californias stock contractor. Information on professional rodeo production and the original 'Born to Buck' program.
Rodeo Prca Fair Ndash County Bull Sun Bulls Sat Riding Charro Flying Fiesta Thur Only
Californias stock contractor. Information on professional rodeo production and the original 'Born to Buck' program.
Rodeo Prca Fair Ndash County Bull Sun Bulls Sat Riding Charro Flying Fiesta Thur Only
6 California Skateparks
General contractor
General contractor for concrete skateparks. Includes references, company profile, resume, and contact information.
Rejected Requesty
General contractor for concrete skateparks. Includes references, company profile, resume, and contact information.
Rejected Requesty
7 A-1 Miniature Golf Design and Construction
Contractor profile
Contractor profile and information on services and projects building miniature golf courses.
Navigationshilfey
Contractor profile and information on services and projects building miniature golf courses.
Navigationshilfey
6. Society, Arts and Contractor Crafts
1 Working as an Independent Contractor
Article covering
Article covering the pros and cons of becoming an independent contractor and how to get started.
Independent Contractor Careers Contractors Jobs Resignation Policy Tech Letter Job +t+ Privacy Learn Consulting Aboutcom Tax
Article covering the pros and cons of becoming an independent contractor and how to get started.
Independent Contractor Careers Contractors Jobs Resignation Policy Tech Letter Job +t+ Privacy Learn Consulting Aboutcom Tax
2 Independent Contractor Agreement
Sells a
Sells a lawyer-approved standardized contract to use as a guideline when customizing a contract for an independent contractor or freelancer.
Independent Contractor Agreement Freelance Sample Contract Contact They Policy Word However Professional Freelancer Privacy Documents Payment
Sells a lawyer-approved standardized contract to use as a guideline when customizing a contract for an independent contractor or freelancer.
Independent Contractor Agreement Freelance Sample Contract Contact They Policy Word However Professional Freelancer Privacy Documents Payment
3 Ankida
Independent contractor
Independent contractor positions with training through this company. Details of packages, experience required, and what to expect.
Z Y
Independent contractor positions with training through this company. Details of packages, experience required, and what to expect.
Z Y
4 realty signatures
nationwide services.
nationwide services. offers online service ordering and independent contractor information.
Soon Future Cool Something Coming Check Owner Visitoryoure Launch Please Z
nationwide services. offers online service ordering and independent contractor information.
Soon Future Cool Something Coming Check Owner Visitoryoure Launch Please Z
5 coastal closings
serves the
serves the state of florida. offers services, independent contractor sign up and invoicing, and contacts.
Mobile Florida Notary Services Signing Contact Notaries Invoice Company County Miami Calendar Rescission Closings Throughout
serves the state of florida. offers services, independent contractor sign up and invoicing, and contacts.
Mobile Florida Notary Services Signing Contact Notaries Invoice Company County Miami Calendar Rescission Closings Throughout
6 sea hawk enterprises, inc.
construction management
construction management and consulting firm with over 28 years experience as california, arizona and nevada licensed contractor.
年月 年月日 日記 Wordpress Ocnã®格安simã§節約 観光スãƒÂット Just 上è«Â訪温泉 格安simã«変ãˆã¦ã‹ら ãÂÂã®後1 インフルエンザã®æµÂè¡Œ メãƒÂンパン 家æ—Âæ—…è¡Œââ€â€šÃ£ÂŠã™ã™ã‚Â情報 洗濯物ã®ä¸Âã«蜂 Rss Wordpressorg
construction management and consulting firm with over 28 years experience as california, arizona and nevada licensed contractor.
年月 年月日 日記 Wordpress Ocnã®格安simã§節約 観光スãƒÂット Just 上è«Â訪温泉 格安simã«変ãˆã¦ã‹ら ãÂÂã®後1 インフルエンザã®æµÂè¡Œ メãƒÂンパン 家æ—Âæ—…è¡Œââ€â€šÃ£ÂŠã™ã™ã‚Â情報 洗濯物ã®ä¸Âã«蜂 Rss Wordpressorg
7 john sevier
a certified
a certified arborist, tree maintenance contractor, and court qualified tree safety expert.
Tree Expert Accident Sevier Witness Johnny Braunfels Insurance Pruning Management Contact Trees Removal New Wrongful Consultant Arborist
a certified arborist, tree maintenance contractor, and court qualified tree safety expert.
Tree Expert Accident Sevier Witness Johnny Braunfels Insurance Pruning Management Contact Trees Removal New Wrongful Consultant Arborist
8 john sevier
certified arborist
certified arborist, tree maintenance contractor, and court qualified tree safety expert.
Tree Expert Accident Witness Contact Sevier Power Line California Public Cases Services Johnny Crape Myrtles Latest Depending
certified arborist, tree maintenance contractor, and court qualified tree safety expert.
Tree Expert Accident Witness Contact Sevier Power Line California Public Cases Services Johnny Crape Myrtles Latest Depending
9 christopher t. restak
hanover attorney
hanover attorney, with experience as a construction lawyer, architect, general building contractor and attorney.
Learn Construction Attorney Providing Practice Video Profile Mrsfields Practice Realdevelopment Related Issues Estate Fine Clients
hanover attorney, with experience as a construction lawyer, architect, general building contractor and attorney.
Learn Construction Attorney Providing Practice Video Profile Mrsfields Practice Realdevelopment Related Issues Estate Fine Clients
10 clinton j. ford p.a.
florida based
florida based general contractor providing consultation, litigation support and expert witness testimony for construction claims, delays and damage cases.
Construction Building Environmental Mold Consulting Expert Information Estimating Advanced Consultants Witness Glossary Resources Gallery Florida Each Defensive Resources We
florida based general contractor providing consultation, litigation support and expert witness testimony for construction claims, delays and damage cases.
Construction Building Environmental Mold Consulting Expert Information Estimating Advanced Consultants Witness Glossary Resources Gallery Florida Each Defensive Resources We
11 competitive solutions group
expert witness
expert witness for plant damage, contractor performance and related project deficiencies in the cable television and local exchange carrier industries. located in illinois.
Navigationshilfe Ty
expert witness for plant damage, contractor performance and related project deficiencies in the cable television and local exchange carrier industries. located in illinois.
Navigationshilfe Ty
12 the pd group unlimited, inc.
serves indian
serves indian river, broward, palm beach, st. lucie, martin counties. offers services, fees, contacts, online ordering, and client and contractor registration.
Navigationshilfe Ty
serves indian river, broward, palm beach, st. lucie, martin counties. offers services, fees, contacts, online ordering, and client and contractor registration.
Navigationshilfe Ty
13 Boeing T-45 Training System
Offers background
Offers background information, simulators, training integration, instructional programs, contractor logistic support, news releases, photos, and multimedia in .avi and .mov formats.
Boeing Space Learn Defense Global System Commercial Engagement Merchandise Launch United Multimedia Phantom Military News Series Frequently Cybersecurity
Offers background information, simulators, training integration, instructional programs, contractor logistic support, news releases, photos, and multimedia in .avi and .mov formats.
Boeing Space Learn Defense Global System Commercial Engagement Merchandise Launch United Multimedia Phantom Military News Series Frequently Cybersecurity
14 Home Envy: Mag Ruffman
Archive of
Archive of DIY projects and guides. Mag Ruffman worked as a licensed contractor before hosting televisions A Repair to Remember and Anything I Can Do. Information geared to women doing home repairs.
Homes $ Springs Colorado Sale Estate Real Stone Fort Carson Views Stucco Custom Flying Creek Popular New Guide Convenient
Archive of DIY projects and guides. Mag Ruffman worked as a licensed contractor before hosting televisions A Repair to Remember and Anything I Can Do. Information geared to women doing home repairs.
Homes $ Springs Colorado Sale Estate Real Stone Fort Carson Views Stucco Custom Flying Creek Popular New Guide Convenient
15 glass mediations
douglas a.
douglas a. glass,esq. civil mediations and arbitrations related to real estate, construction defects, contractor disputes, and personal injuries. based in san diego, california.
Mediations Glass Diego Doug Calendar Mediator Douglas California Learn San Practice Areas Mediators Claims Page
douglas a. glass,esq. civil mediations and arbitrations related to real estate, construction defects, contractor disputes, and personal injuries. based in san diego, california.
Mediations Glass Diego Doug Calendar Mediator Douglas California Learn San Practice Areas Mediators Claims Page
1 donahue design
custom murals
custom murals and faux finishes and workshops by anna donahue, professional artist and licensed contractor.
Domain Sale Now Premium Artmuralcom Request Price Maximize Domainmarketcom Buy Ready@ Now_ Easily
custom murals and faux finishes and workshops by anna donahue, professional artist and licensed contractor.
Domain Sale Now Premium Artmuralcom Request Price Maximize Domainmarketcom Buy Ready@ Now_ Easily
2 dannenbeck studios
sculptor and
sculptor and designer/contractor team up to design, fabricate and install both public and private site-specific sculptural tile artworks and large scale ceramic sculptures.
sculptor and designer/contractor team up to design, fabricate and install both public and private site-specific sculptural tile artworks and large scale ceramic sculptures.
3 Home Envy: Mag Ruffman
Archive of
Archive of DIY projects and guides. Mag Ruffman worked as a licensed contractor before hosting televisions A Repair to Remember and Anything I Can Do. Information geared to women doing home repairs.
$ Homes Colorado Springs Sale Real Ranch Estate Peak Horse Pikes Communities Page Property |
Archive of DIY projects and guides. Mag Ruffman worked as a licensed contractor before hosting televisions A Repair to Remember and Anything I Can Do. Information geared to women doing home repairs.
$ Homes Colorado Springs Sale Real Ranch Estate Peak Horse Pikes Communities Page Property |
Contractor Dictionary
contractile organ / contractor: a bodily organ that contractscontractor: someone (a person or firm) who contracts to build things
contractor: (law) a party to a contract
contractor declarer: the bridge player in contract bridge who wins the bidding and can declare which suit is to be trumps
defense contractor: a contractor concerned with the development and manufacture of systems of defense
SiteBook.org Reviews for Contractor. The business hours may vary on holidays like Valentines Day, Washingtons Birthday, St. Patricks Day, Easter, Easter eve and Mothers day - Statistics: 4 SiteBook Points for "Contractor" (visitors of this topic page). Contractor › Reviews & Experience Experience and Review Contractor Opening Times and Reports. Date:
Our Recommendations:
Contractor may refer to:
4 results for Contractor: Contact Contractor Services Company Air Z Commercial Construction Y Heating Conditioning We