Topic: OR City:
Best reviews ›

Freelancer contractor Experience

Freelancer contractor

1 Home Quality Remodeling Remodeling
94520
Concord
We always put the home remodeling and renovating needs of our clients first. We continuously strive to be market leaders...
homequalityremodeling.com/ We Remodeling General Concord San Home If What Jose Ave Contractor Office Quality Suite End
2 Diamond in the Rough Property Solutions Contractor
44681
Sugarcreek
Diamond In The Rough Property Solutions is a custom interior remodel contractor specializing in custom kitchens and bathrooms. We are...
diamondintheroughllcoh.com/ We Canton Call
3 Looking for Corporate Waterproofing Contractor Odisha Waterroofing
75100
Bhubaneswar
BuildingKaDoctor the most preferred waterproofing service provider providing top-notch services under a competitive market price....
buildingkadoctor.com/water-proofing.html We Applying No It After Waterproofing This Our Cleaning Ka Doctor The Steps Advantages Building
4 CMi Air Conditioning & Electrical HVAC Contractor
33403
Lake Park
CMi has been serving residents and businesses in Palm Beach, Martin and St. Lucie Counties since 1992. So, we’ve been...
cmi air conditioning & electrical
5 Edwards Air Ent LLC HVAC Contractor
33458
Florida City
Edwards Air Ent LLC is a full-service HVAC contractor that offers air-conditioning installation, maintenance, and repair services for heating and...
edwardsairenterprise.com
6 Liberty Hill Fence Company Fencing
78642
Liberty Hill
Top-quality Fencing in Liberty Hill, TX We are Liberty Hill’s Top fence builder and we are here to provide world class...
libertyhillfencecompany.com/ Fence Liberty Hill Fencing Newtown Contractor Installation We Repair Company Our Fences Contact Best Commercial
7 Gonzales Custom Decking CONTRACTOR
78629
Gonzales
Master Deck Builder in Gonzales, TX At Gonzales Custom Decking we offer a wide range of services to create the ultimate...
57 country road 4702
8 Bulverde Fence Contractor Pros FENCE CONTRACTOR
78163
Bulverde
Bulverde Fence Contractor Pros 2482 Hiline Dr Unit 101, Bulverde, TX 78163, United States +18302515461 https://bulverdefencing.com/ https://www.google.com/maps?cid=3086992068660255106 Premier fencing contractor in Bulverde We are Bulverde Fence...
bulverdefencing.com/ Fence Bulverde Fencing Contractor Newtown Installation We Repair Best Our Fences Company Contact Professional Commercial
9 Bannister Heating and Air of Tyler HVAC
75702
Tyler
Top Rated HVAC Contractor in Tyler, TX Bannister Heating and Air of Tyler, Our HVAC experts have been helping customers maintain...
bannisterplumbingandair.com/hvac-tyler/ Tyler Air Bannister Heating We Our Plumbing Font Texas Services If Water Contractor Jacksonville East
10 LOS ANGELES CONCRETE & FRAMING CO Concrete Contractor
91324
Northridge
Trusted concrete contractor in Los Angeles, Los Angeles Concrete and Framing CO is your go-to source for high-quality concrete services...
lacfco.com/ Concrete Framing Angeles Los Co Contractor We Us Services Get More Southern California Read Our
11 Bathroom Remodeling Contractor In CA Home Additions
91607
Los Angeles
Green Tech Remodeling & Design INC has been a trusted name for Bathroom Remodeling for years. Our Bathroom Remodeling Contractor...
greentechremo.com/bathroom-remodeling-california Ba Objectassign Kcp Rp Kri Rt Kvo Stylable Mp Rex Hl Rl Datenow Functionconst Mathmax
12 Bannister Plumbing & Air Services
75766
Jacksonville
Bannister Plumbing & Air is the company to call for all your plumbing & HVAC needs. We work with residential...
bannisterplumbingandair.com/ Plumbing Jacksonville Air Bannister Texas East Tyler Font Contractor Water Plumber Cleaning Call We Heaters
13 NorthCraft Deck Staining Services Deck Staining
60137
Glen Ellyn
Deck staining and cleaning services. Professional deck or fence painting and sealing company....
northcraft-deck-staining-services.com Deck Staining Company Regular Fence Play Cleaning Washing Sealing Services Painting Regularwoff Contractor Service North
14 Pflugerville Expert Roofers Roofing Contractor
78660
Pflugerville
ROOFING CONTRACTOR OF PFLUGERVILLE, TX We are your locally owned and operated full-service storm restoration team. We pride ourselves on providing...
roofingpros-pflugervilletx.com/ Roofing Pflugerville Roofers Expert Roof We Pros Contractors Contact Commercial Residential Repair New The Company
15 B.C. Fence Home Improvement

A Fencing Company specializes in providing high-quality fencing solutions for a variety of needs. B.C. Fence offers installation, repair, and...
bcfenceaustin.com/ Fence Code Austin Fencing Company Installation Commercial We Park Contractor Cedar Arial Helvetica Fences Repair
16 EME Flooring Flooring Contractor
30307
Atlanta
We are a flooring company that provides installation and repairs for tiles, vinyl, laminate, hardwood, and carpet flooring. We also...
emeflooring.com Flooring Atlanta Company Installation Our Commercial Georgia Smyrna Brookhaven Marbleton East Point Residential Luxury Vinyl
17 Home Improvement Contractor - Zicklin Contracting Construction
10005
New York
For the best Home Improvement Contractor In The New York Area, you can trust Zicklin contracting. Our track record of...
99 wall st suite 1960, new york, ny
18 General Contractor in Orlando General Contractors

Benchmark Building Group is a Trusted General Contractor Orlando catering to Commercial and Residential Construction Clients in Central Florida. As...
benchmarkbuildinggroup.com Orlando Construction Florida Contractor Building General Commercial Company Outs Central Renovations Build Benchmark Group Custom
19 Manassas Concrete Co Concrete Contractor
20111
Manassas
Our team of experts has years of experience in the industry, and we’re dedicated to delivering superior service to each...
manassasconcrete.com/ Concrete Manassas We Pros The Contractor Co Our What Learn They No You Service Services
20 Paskoski Construction General Contractor
33316
Fort Lauderdale
Paskoski Construction has established a distinguished reputation for its rigorous approach to custom home building. It has professional General Contractor...
paskoskiconstruction.com/ Home Construction Florida Paskoski South Fort Lauderdale Builder Inc Luxury Letter Beach Us Custom Estate
21 Cliff Nicholls Roofing & Scaffolding Limited Roofing Contractor
113
Wolverhampton
Cliff Nicholls is an established roofing contractor in Wolverhampton; they offer services from storm damage work to tiling and slating...
cliffnicholls.co.uk/ Roofing Wolverhampton Cliff Nicholls Roof Contractors Our Repairs Get Rubber Find We Work Call Flat
22 Floor Sanding Melbourne Flooring Contractor
3216
Melbourne
At our company, we are proud to offer top-quality timber floor sanding services in Melbourne.Our team of experienced sanders uses...
floorsandingmelbourne.com/ Poppins Roboto Sans Open Melbourne Arial Helvetica Lucida We Floor Sanding Uv Contact Polishing With
23 Cliff Nicholls Roofing Contractors Roofing Contractor
113
Wolverhampton
Cliff Nicholls is an established roofing contractor in Wolverhampton; they offer services from storm damage work to tiling and slating...
cliffnicholls.co.uk/ Roofing Wolverhampton Roof Cliff Nicholls Contractors Repairs Our Get Find Work We Rubber Flat Call
24 Burberry Construction LLC Roofing Contractor
07747
Matawan
Specializes in Roofing and Bathroom Remodeling! We will assist with material choice, design, and complete the installation or remodeling to...
burberryconstruction.com/ Construction Burberry Repair Installation New Jersey Roof We Shingle Flat Rubber Slate Services Home Get
25 Green Kings Landscaping Landscaping Services
3029
Melbourne
Green Kings Landscaping is Melbourne located business and offering various services such as Deck Builder, Excavation & Hire Service, Grounds...
greenkingslandscaping.com.au/ White Text Kings Landscaping Green Melbourne Blue Divider Designers Contractor Get Nitro Landscape Professional Ufunctione
26 Custom Wooden Driveway Gates Dallas TX Home Service

If you are in search of a trustworthy company to build and install Custom Wooden Driveway Gates & wood fence...
prestonhollowfence.com/ Fence Automatic Driveway Gates Wood Richardson Hollow Contractor Gate Custom Cedar Railings Finest Arial Contractors
27 Custom Driveway Gates Richardson TX Home Service
75081
Richardson
At Preston Hollow Fence Company, we offer Custom Driveway Gate in Richardson TX, Dallas TX and surrounding areas that are...
prestonhollowfence.com/ Fence Automatic Driveway Gates Wood Richardson Hollow Contractor Gate Custom Cedar Railings Finest Arial Contractors
28 Steamatic of Grand Forks Air Duct
58203
Grand Forks
We have been in the restoration and cleaning business for over 20 years. Our professionally trained employees specialize in providing...
steamaticrrv.com/ Red River Valley Restoration Near Fargo Grand Forks Steamatic Dateget Cleanup Call Stringfrom Arial Arrayflag
29 Mr. Rooter Plumbing of Phoenix Arizona Plumber Contractor
85210
Mesa
Mr. Rooters singular priority is to provide the highest level of customer service. This is done by providing a world-class...
mrrooter.com/phoenix
30 Wooden Fence Contractors Richardson TX Contractors

Richardson
Here at Preston Hollow Fence Company, we have a team of professional Wooden Fence Contractors in Richardson TX that are...
prestonhollowfence.com/ Fence Automatic Driveway Gates Wood Richardson Hollow Contractor Gate Custom Cedar Railings Finest Arial Contractors
31 Fence Company in Addison Texas Home Improvement
75081
Richardson
If you are wondering for security, style, or privacy, we have the best fencing solution for your property, your yard...
prestonhollowfence.com/about/ Fence Company Contractor Construction Professional Dallas Automatic Gates Slide Gate Arrayflag Richardson Hollow Preston Arial
32 Roofing Contractor in Ijamsville MD Home Improvement
21754
Ijamsville
Eastern Exteriors, LLC Specialize in Roofing and Storm Damage Restoration in Ijamsville, MD. Let Us Restore Your Home With a...
easternext.com Index Storm Restoration Opening Ijamsville Name More Services Roofing Siding Contractor They Exteriors About Damage
33 Fitzgerald Plumbing Plumnbing And
90712
Lakewood
Fitzgerald Plumbing promises availability. We love helping our neighbors fix their plumbing problems. For us, it’s all about seeing the...
fitzplumbing.com Plumbing Lakewood Affordable Local Contractor Plumber Stringfrom Arial Arrayflag Status Loaded Transient Mathroundh Get Call
34 Electrical Contractor West Palm Beach Electrical

Want to hire State Certified Electrical Contractor in Delray Beach or West Palm Beach for your residential, commercial and industrial...
alphatecelectric.com/ Beach Palm About West Electrician Us Electric Alphatec We Electrical Alpha County Services Skip Contact
35 Parking Lot Maintenance Paving Contractor
63367
Lake St Louis
Incorporated in 1997, Parking Lot Maintenance specializes in the maintenance of asphalt parking lots. Our services include seal coating, hot...
parkinglm.com Parking Lot Maintenance We Louis Read Sealcoating Saint Our Sealing St Contact White Paper Lots
36 XS Worldwide - Exhibition Stand Contractor Exhibition Stand

Dubai
Looking for exhibition stand contractors? Want to showcase your brand in a unique way? XS Productions Worldwide is here to...
xsproductions.com/
37 Sears Heating & Cooling HVAC Contractor
43224
Columbus
Sears Heating and Cooling was founded in Columbus, Ohio in 1950 by Johnny Sears and his family. We are family...
searsheatingcooling.com
1 Contractor Umbrella Provides an
Provides an administrative and payroll solution to IT contractor clients who do not wish to set up their own limited company.
Umbrella Company Contractor Contractors Companies Ir Hmrc Compliance Gt Expenses Contract Contracting Take Limited Awr
2 AJECT Contractor operating
Contractor operating in the Middle East, tunnelling as a specialist contractor.
Z Aject Y
3 Charles Blanchard Construction Corporation Licensed general
Licensed general contractor and historic restoration contractor in Charleston, South Carolina.
Division Construction Commercial Charles Blanchard Charleston Mechanical Corporation Industrial Cbcc Historical Team Email Upcoming Project
4 R.C. Austin 25 years
25 years as an electrical contractor serving Port Carling & Muskoka Lakes cottages and homes. An experienced electrical contractor.
Electrical Muskoka Contractor Port Systems Lighting Carling Plumbing Lakes Austin Generators Rc Homes Commercial Businesses
5 RB Enterprises Electrical Contractor Electrical contractor
Electrical contractor with over 20 years experience. Commercial & residential serving El Paso, TX & surrounding Communities. Licensed & Bonded.
6 Sprinkler System Contractor Full Service
Full Service Fire Sprinkler Contractor Proudly Serving the Southeast Since 1978 Headquartered in High Point, North Carolina
Sprinkler Systems Sunland Fire Protection Carolina Office Employment Automatic Services Projects Contact Quality Tennessee Afsa Point Virginia
7 Contractor Financials Ltd Offers contractor
Offers contractor mortgages, insurance, pension and life insurance.
Contractor Mortgages Insurance Mortgage Pensions Guide Protection Income Life Financial Click Here Critical Pension Personal First Writing
8 PHP Freelancer PHP jobs
PHP jobs and contract work auction.
9 Francisco Liaci Translation freelancer
Translation freelancer based in Salta, Argentina.
Requested Foundmissingcontact Please Page
10 Yury Efimenko Freelancer based
Freelancer based in Canada, focused on both languages.
11 Jenny Lu Translation in
Translation in English and Chinese by freelancer in unknown location.
Wordpresscomgoogle Clearing Instructionserror Whoops Your
12 Shine Qiu Translation and
Translation and interpreting from Chinese to English. Freelancer based in China.
13 Miguel Llorens Financial and
Financial and legal translation. Freelancer based in Venezuela.
Translator Financial Spanish English Economics Finance Llorens Rgft Source Documentshbo Servicio Specialized Traduccioacuten
14 Andrei Sedliarou Translation and
Translation and interpreting by freelancer based in Minsk, Belarus.
Russian Thai Translation Services English Thailand Translator Belarusian Interpreter Interpreting Certified Phuket Pattaya Localization Voice Free
15 Insul-Crete Concrete Floor Roof Sound Geotechnical Installation Contractor Fresno CA The leading
The leading construction contractor installing lightweight cellular concrete, gypsum based underlayments and insulating concrete roof systems.
Z Y
16 Maurizio Valente Technical translation
Technical translation from English into Italian. Freelancer based in Italy.
17 Ms Daniela Kabak Translation and
Translation and interpreting in Bulgarian<,>,English. Freelancer based in Bulgaria.
Yahoo Geocities Sign Copyright Policy Help Terms Financemachine Longeravailable Hosting Mail Maps Reach
18 Tom Popielaz Translation in
Translation in English<,>,Polish. Freelancer based in Florida, United States.
Polish English Translator Popielaz Translations Poland Tips Translatorcom Learning Weekends Member Tofrom Translate Teams Y
19 Siarhei Ananin Translation in
Translation in English<,>,Russian/Belarusian. Freelancer based in Belarus
20 J Yurulain Translation and
Translation and localisation in Malay and English. Freelancer based in Republic of Singapore.
Yahoo Geocities Copyright Help Sign Policy Movies Newssorry Finance Internet Hosting Longeravailable Wayback
21 Central Service and Supply Serves the
Serves the construction, aggregate, mining and contractor market segments with rock crushing equipment, screening plants, wire cloth, pumps, chains & hoists, washing & classifying equipment, drilling equipment, conveying equipment and contractor equipment rental.
Learn Equipment Supply Learnmore Central Water Pumps Inc Mining Products Slings Hoists Moines Lifting Studios Crushers Chain Catalog
22 Igor Maslenikau Interpreting in
Interpreting in German, English and Russian. Freelancer based in Vancouver, Canada.
23 OzeVision Translation in
Translation in Urdu, Norwegian and English. Freelancer Faiza Syed, based in Australia.
24 Julia Barbalace Freelancer based
Freelancer based in Portland Maine, United States, focused on both languages.
Julia English Russian Translation Quote Interpretation Request Services Contact Professional Barbalace Work Effectively Glossary Website Portland Proofreading
25 Mohammed Hussein [Pop-ups] Translation
[Pop-ups] Translation and typesetting in Arabic-English. Freelancer based in unknown location.
26 Hadia Rashed Translation and
Translation and marketing in English-Arabic. Freelancer based in Alexandria, Egypt.
27 Claudia da Matta Translation and
Translation and localisation in English>,Portuguese. Freelancer based in the United States.
28 André Leroux Translation and
Translation and localisation in English and French. Freelancer based in Euralille, France.
29 Enrique Nestor Garcia Conference interpreting
Conference interpreting in English and Spanish. Freelancer based in Canada.
30 Atikah Technical translation
Technical translation from English to Malay. Freelancer based in Johor Bahru, Malaysia.
Yahoo Geocities Sign Policy Copyright Help Machine Games Archiveorgnews Archives Visit User Mail Trying Privacy
31 Yeminli Tercüme Translation in
Translation in Turkish, Russian, Romanian and Moldovian. Freelancer based in Turkey.
32 PolskaTran Translation in
Translation in English and Polish by freelancer named Ewelina, based in the United States.
33 Duckworth, John Freelancer based
Freelancer based in Queensland, Australia, specialising in sporting events and model portfolios.
Yahoo Geocities Help Copyright Sign Policy Termsarchiveorg Internet Longeravailable Maps User News Finance
34 Phil Gibbon Translation from
Translation from Japanese to English for the games industry. Freelancer based in Tokyo, Japan.
35 I-An (Annie) Tseng Interpreting and
Interpreting and translation in Chinese and English. Freelancer based in Monterey, CA, United States.
36 Julia Winkler Translation and
Translation and interpreting in Russian, German and English. Freelancer located in Munich, Germany.
37 Dorota Chmielewska Certified translation
Certified translation in French/Polish/Romanian. Freelancer based in Warszawa, France.
T³umacz T³umaczenia Francuskiego Przysiêg³y Tlumaczenia Portfolio Tlumacz Francuski Rumuñski Zobacz Poeta Przysiegly Rumunskiego Gin±cego Próba Narodu Traducator
38 Suzan Blankschtein Chin Translation and
Translation and DTP in Hebrew and English. Freelancer based in San Diego, CA, United States.
39 Sormane P Gomes Translation and
Translation and interpreting in Portuguese<,>,English. Freelancer based in Philadelphia, United States.
Z Y
40 Write for Business Writing services
Writing services in English and translation from Dutch. Freelancer based in Oegstgeest, The Netherlands.
41 Sudibyo Siyam [Flash needed]
[Flash needed] Sworn translation in English and Indonesian. Freelancer based in Indonesia.
42 Gaguzia Translation from
Translation from Hebrew, Russian, and French to English. Anonymous freelancer based in Karmiel, Israel.
Translations English Leading Toenglishtranslationcom Translation Japaneseforeign Siteon Interpreters Chinese Languagetranslators Data
43 Sederholm, Kristine Multimedia and
Multimedia and graphic design portfolio from Vancouver, British Columbia based Freelancer.
44 Ashburner, Andy Online portfolio
Online portfolio of graphic and web designs for Freelancer based in London, England. Clients list.
Design London Web Development Graphic Shoreditch Iphone Clients Caffeinehit Contact Mobile Bespoke Logo Ltd App Client
45 Yeeware Portfolio and
Portfolio and resume for freelancer includes fine art, digital media and website designs. Atlanta, Georgia.
Yeeware Yee Steve Handmade Artist Painter Gift Ware Jamaica Ornament Tablewarevase Painting Candlestick
46 Celine L Cavallo [Flash needed]
[Flash needed] Translation of medical research papers. Freelancer based in unknown location.
Translator Medical Traductor Traducciones Celine Translations Cavallo Freelance Research Inglés Científico Spanish De English Médico Y
47 Muhammad Razin Ong Abdullah Translation of
Translation of computer related texts in English and Malay. Freelancer based in Malaysia.
Z Y
48 Michael Wasserman Certified interpreting
Certified interpreting and translation in English, Russian and Latvian. Freelancer based in the United States.
49 Hannibal Brown Translation and
Translation and adaptation of film scripts, lipsync and ADR. Freelancer based in Florida, United States.
50 RussianExpertise Translation, localisation
Translation, localisation, term and project management and DTP in English<,>,Russian. Anonymous freelancer in an unknown location.
51 Carl Vega Interpreting and
Interpreting and language teaching in Spanish and English. Freelancer based in New Jersey, United States.
52 ArabLinguist Translation, interpreting
Translation, interpreting, DTP and ME consultation in Arabic and English. Anonymous freelancer based in California, United States.
Arabic Translation English Translator Certified Professional Interpreter Interpreting Delivery East Services Overnight Documents Electronic American
53 Istvan Konok Translation from
Translation from English, French, German and Spanish into Hungarian. Freelancer based in Budapest, Hungary.
54 Maciej Machniewski Translation, teaching
Translation, teaching, and lexicography in English and Polish provided by a freelancer based in Poznan, Poland.
55 Hullegardtranslations Translation from
Translation from English, German, French and Dutch to Swedish. Freelancer Emelie Hulleg?rd based in Sweden.
Swedish Translations French German Dipl Traductions Eng Ger översättningar Till Dutch Suedois Svenska Swe English Technische Wirtschaft
56 Teri Szucs Certified court
Certified court interpreting from English into Spanish. Freelancer based in California, United States.
Spanish Certified Court Interpreter Teri Szucs Interpretations California Federal Posts Courts Skip Los Sidebar Federally
57 Anglissima Conference interpreting
Conference interpreting, translation and copywriting in German. Freelancer Kerstin Mareile Funke based in Neubrandenburg, Germany.
Dolmetschen Texten Mareile Funke English Kerstin Englisch Anglissima übersetzen Sprache Geschriebenes Text Bersetzen Deutsch German
58 Diana DallOcchio Translation and
Translation and court certified interpreting in English and Spanish. Freelancer based in California, United States.
59 Words in Transition Copy editing
Copy editing, copywriting and proofreading in English by freelancer Donna Devine, based in Delft, the Netherlands.
60 Translate & Edit Translation in
Translation in Chinese-English of papers, thesis, documents and manuals. George, freelancer based in Taiwan.
61 Samuel Murray-Smit Translation from
Translation from English into Afrikaans by freelancer based in Johannesburg. Site in both languages, with related articles.
62 Britalink Medical and
Medical and legal interpreting in French and English. Freelancer Emmanuel Sombsthay based in Rennes, Brittany, France.
Formation Traduction Anglais Cours Interprétariat Professionnelle Français Rennes Britalink Bretagne Interprétation Conférence Danglais English Institut Opca
63 Osa K Bondhus Translation in
Translation in English and Norwegian in the computer, multimedia and general business fields. Freelancer based in the United States.
Found Comcasty
64 Giampiero Romani Technical translations
Technical translations in English>,Italian in engineering, construction and industry sectors. Freelancer based in Italy.
65 Kristin Alynn Sinclair Instruction, translation
Instruction, translation and writing in English and Norwegian. Freelancer based in Norway. Bilingual web site.
Click Here Free Freeservers Page Area Website Member Web Support Building Technical Hosting Photos Tools Default
66 Ayntran International Trilingual Translations Translation in
Translation in French/German/Spanish-English. Aynslie Reimer, freelancer based in Canada.
Domain Ayntrancom Programm Parking Website Inhaber Informationen Beacons Thema Infohtmlcategory=keyword=token= Ayntran Beste Erste Beziehung Policies Verkauf Ayntrancome Listings
67 Minoo Razban Interpreting, translation
Interpreting, translation, transcription, proofreading and editing in Farsi/Dari/English. Freelancer based in the United Kingdom.
68 Teri Szucs Federal court
Federal court certified Spanish interpreter. Freelancer based in Los Angeles county, California, United States.
69 Armando Oterino Translation in
Translation in English and Spanish in the fields of biological science, agriculture, horticulture and the environment. Freelancer based in Spain.
70 Heather Hayes Certified federal
Certified federal court interpreter in English, Spanish and Catalan. Freelancer located in Tennessee, United States.
71 Japanese Translation Service Toronto based
Toronto based freelancer specializing in film and video. Past clients, rates, and educational background presented.
72 Sara Jane [Half-nude pictures]
[Half-nude pictures] Translation, interpreting, escorting and hostessing by freelancer from Europe. Single page with list of skills.
Free Website Angelfire Hosting Builder Web Angelfires Smashing Templates Knowledgebase School Domain Support Express Welcome Page Privacy Homepage Place
73 Celine Detraz Conference interpreting
Conference interpreting and voice talent work in English and French. Freelancer based in San Francisco Bay Area, United States.
74 zipperstudios Provides traditional
Provides traditional and new media design through a team of freelancer and contract designers. Offers portfolio and client list. Based in Dallas, Texas.
Z Y
75 Kathi Stock Certified translation
Certified translation and interpreting in English and German. Freelancer based in Dallas/Fort Worth, Texas, United States.
76 Air Mail Translations [Flash needed]
[Flash needed] United Kingdom based service translating from Spanish and Portuguese into English. Freelancer Shirley Brotherton-Pinniger.
77 Traduzioni Adesso Translation from
Translation from English into Italian, with 24-hour turnaround. Large glossary collection. Freelancer Paolo Roat based in Trento, Italy.
78 Christian Flury Interpreting, translation
Interpreting, translation, localisation and proofreading in German, French, Italian and English. Freelancer based in Vienna, Austria. Site in four languages.
Server Internal Error Please Additionally Apache Port Error Theerrordocument Z
79 Alex Sorokin Translations Freelancer translations
Freelancer translations from English into Russian, Byelorussian.
Create Tripod Checklogin Please Hosting Tripodcom Couldnt Lycoscom Signup Website Pagerequested Shopping
80 Get a Freelancer At a
At a small commission, programmers can bid on projects and buyers can post their projects.
Freelance Sign Hire Step Terms Jobs Freelancers Request Conditions Looking Work Developers Forgot Policy Now
81 Belis Translation in
Translation in Slovak<,>,English. Freelancer Slavomir Belis based in the United Kingdom.
Slovak English Translation Translate Translations Slavomir Individuals Corporations Subtitling High Translatorquality Alike Proverbs
82 Italian Translator Translation service
Translation service from Italian into English. Freelancer Stephen Bermingham Pastorello.
83 Twenty First Century Translation Swedish and
Swedish and English translation by freelancer.
84 Toon Gevaert Interpreting and
Interpreting and translation in English and Spanish. Freelancer based in Belgium. Site in English and Dutch.
85 Yiqi Translation Services Translation from
Translation from Chinese to English. Freelancer based in Heilongjiang Province, Harbin, China.
Chinese English Translations Translation Native Brown Services Yiqi Edward China Speaker Option Toolbar Northeastern Thanks
86 Brinckmann International Translation in
Translation in technical and business fields. Freelancer Jennifer Brinckmann based in Guadalupe, Mexico.
Spanish Translations Mexican English Translation Internet Here Better Only Website Free Translate Websites Point Hispanics Piensa Order Spanishspeaking
87 Veterinary Translations Translation from
Translation from English and Swedish into German. Freelancer and veterinary surgeon Tanja Orlich based in Sweden.
Yahoo Geocities Websiteinternet Rechtliche Clever Feld Spiele Inc Nachrichten Datenschutzbestimmungen Machine Rechte Reisen
88 Bulgarian Translator Translation and
Translation and interpreting in Bulgarian<,>,English. Freelancer Vlaiko B Boyadzhiev based in Seattle, United States.
This Sorrycontactfrozenwere Frozen Please Owner
89 JB Spanish Translator Translation from
Translation from English into neutral Spanish or localized for Spain. Freelancer Jaime Bonet based in France.
90 Napos Oldal Translation in
Translation in Hungarian, Croatian, Czech, Estonian, Latvian, Lithuanian, Polish, Romanian, Russian, Serbian, Slovak and Slovenian. Freelancer based in Hungary.
Napos Oldal Central Translation European Translations Agency Europe Interpreting Eastern Lokalizace Click Servces Here Kapcsolat Quick Localized
91 Inna Olson Translation, transcription
Translation, transcription and telephone translation in English>,Russian/Ukrainian. Freelancer based in Richardson, TX, United States.
92 Horne Translations Translation from
Translation from Chinese, French, Japanese and Latin into English. Freelancer Scott Horne based in Montreal, Quebec.
English Horne Translation Chinese Translations Canada French Français Translator Japanese Montreal Montréal Fonts Québec Latin Media
93 Chinese Interpreter Interpreting in
Interpreting in Chinese and English, and translation in Taiwanese and Hokkien. Freelancer Su-jen (Rita) Huang based in Brisbane, Australia.
Yahoo Geocities Mail Messenger Flickr Archiveorg Guidelines Terms Profiles Trying Wayback Help Video Policy Lifestyle
94 Sandra Nortje Translation from
Translation from Dutch to English, and between English and Afrikaans, in the medical and pharmaceutical industry. Freelancer based in Onrusrivier, South Africa.
Afrikaans Translator English Dutch Nederlands Nortje Gallery Sandra Design Estar Gekooide Litnet Engels Skoppensboer Contact Web Vertalings Fotografie
95 Lindsays Language Service Technical translation
Technical translation and proofreading in English-Chinese-English. Freelancer simply known as Lindsay, based in the United States.
96 Olga Sergyeyeva Translation, editing
Translation, editing and proofreading of English, Spanish and French into Russian and Ukrainian in the medical, computer and technology fields. Freelancer based in Lawrenceville, NJ, United States.
97 Bartletts Peak Communications, Inc. Freelancer specializing
Freelancer specializing in copywriting, creative direction and project management in B2B high tech and health care. Includes information on experiences and portfolio. Illinois.
98 Hazel Tree Translation, editing
Translation, editing, proofreading and project coordination in Spanish, English and Catalan. Freelancer Hazel Whiteley based in United Kingdom.
Management Hazeltree Treasury Hedge Services Solutions Portfolio York Fund Contact Onboarding Risk Technology Hazeltrees Demo Activate Accounting Need
99 Alfacta ?vers?ttningar Translation of
Translation of technical texts, web sites and general texts from Spanish and English into Swedish. Freelancer Anna L Johansson based in Sweden.
100 Mikes Spanish Translations Translation in
Translation in English to Spanish of legal and business documents. Freelancer Michael Taboada Rennard and associates based in United States.
101 Andrew Ferrier Interpreting and
Interpreting and translation in Mandarin Chinese and English, Chinese calligraphy and language tutoring. Freelancer based in San Diego, California, United States.
Click Information Specific Here Sports Toys Tips Finger News Updates Submitted Summer Healthy Weather Basic Appliances Extensions Candida Surgery
102 ABC Italian Translations Translation in
Translation in English >, Italian and proofreading in Italian. Freelancer based in the United States.
103 WordChoice Freelancer experienced
Freelancer experienced in business writing, marketing, advocacy, books, briefings, education, white papers, health and medical, media, music, speechwriting and web writing. Maryland.
Content Wordchoice Services Quality Editing Editorial Copyright Cloudseedcom Clients Wordchoicewrite End Userpublishers Delivers Bestcloudseed
104 School Floor Contractor School and
School and sport floor contractor.
105 Becquey, Marc Experienced freelancer
Experienced freelancer, seeking a position or contracts as a senior web designer, graphical user interface designer or webmaster on a fulltime or contract basis. Bilingual, French and English.
Launch Website Procuron Acnielsen Client Inc Share Graphics Portal Promo Trade Show Communications Launched Emergis
106 Akiko Ikeda Offers English>,Japanese
Offers English>,Japanese translation, interpreting, video translation, translation check, rewriting, copywriting, and writing articles. Freelancer based in Japan.
107 Olena Ingram Translation and
Translation and interpreting in English to Russian or Ukrainian. Freelancer based in Dallas, Texas. [English and Russian]
108 Laerte J Silva Interpreting and
Interpreting and related services in English and Portuguese. Site in English and Portuguese. Freelancer based in Brazil.
109 MedysLex Technical translation
Technical translation and authoring in English>,Spanish and Spanish/English>,Italian. Freelancer Stefano L Oriola based in Spain.
110 El-Nadi, Sahar Arabic/English Voice-over
Arabic/English Voice-over talent, IVR prompts, Ccopywriter, , voice talent, MC announcer, freelancer.
Z Error Y
111 Maloof Language Services Translation and
Translation and certified translation from Spanish, French and Portuguese into English. Certified freelancer based in the United States.
112 Exolangue Translation in
Translation in IT, automotive and tourism texts in English to French. Web site in English and French. Freelancer Arnaud Bachelier based in France.
Translation Translator French English Freelance Exolanguecom Website Organizations Localization Un Eu Union Nations European Betranslated
113 CJ Translation Services Translation mainly
Translation mainly in English, Simplified and Traditional Chinese, Korean and Malay. Anonymous freelancer based in Johor Bahru, Johor, Malaysia.
114 Chen Translation Translation in
Translation in English-Chinese-English. Freelancer based in the United States.
115 Swedish Translation Services Translation in
Translation in marketing, internet, education and engineering fields. Freelancer Terese Whittys company based in the United States. Site in English and Swedish.
Translation Swedish Services English Testimonials Localization Svenska Translator Skype Copy City Projects Editing Professional Follow Mort Blog Business Copyright
116 DWS-Translate Translation English-German-English.
Translation English-German-English. Darlene Waldschmidt-Sematat, freelancer based in Frankfurt am Main, Germany. Site is in both English and German
English German Professional Translation Translations Germany Frankfurt Translate Translatede Service@dws Beach Sandy Toservice@dws Lake Language Y
117 Marco Juliano Technical and
Technical and legal translation of main European languages in São Paulo, Brazil. Freelancer Marco Juliano from Brazil. Site in English and Portuguese.
118 Wyman Indexing Great Indexes
Great Indexes for Great Books, and other media. Experienced professional freelancer available to provide high-quality indexes, information consulting, and other indexing services.
119 Bosnian Translation Services Translation in
Translation in English, Bosnian, Croatian, Serbian and Serbo-Croatian. Freelancer Nenija Hasanic based in Bosnia.
Yahoo Geocities Copyright Policy Help Sign Privacy Archives News Sorrymachine Sites Visit Terms Hosting
120 Alejandra Mantecón Interpreting and
Interpreting and translation from English and French to Spanish. Freelancer based in Madrid, Spain. Web site in Spanish, French and English.
121 Translations English-French-Spanish [Flash needed]
[Flash needed] Translation in English, Spanish and French. Freelancer based in Ireland.
Yahoo Geocities Policy Sign Help Copyright Games Tryinghosting Guidelines Privacy Reach Longeravailable Movies Machine
122 Jia L Vanherreweghe Interpreting in
Interpreting in Chinese-English/Dutch. Freelancer based in Beijing, China. Site in English, Dutch and Chinese.
123 Spartansales.com contractor supplies
contractor supplies and materials.
Now Sale Request Domain Domainmarketcom Price Spartansalescom Buy @ Spartansalescom_thispricenow Welcome Z
124 Afmac LTD Salisbury, UK
Salisbury, UK HVAC contractor.
125 Geophysique TMC A Canadian
A Canadian geophysical contractor.
126 PC Exploration A drilling
A drilling services contractor.
127 KOA Engineering Corporation Iranian HVAC
Iranian HVAC contractor.
Wwwkoa Engcomy
128 All-Bore, Inc. A premier
A premier trenchless drilling contractor.
Z Allborecom Y
129 Glen Electrical Contractors A general
A general contractor.
Z Y
130 Chillaire. Ltd. Full service
Full service UK HVAC contractor.
Chillaire Conditioning Systems Heat Design Solutions Contract Pumps News Maintenance Industrial Installation Consultancy Showers Air Residential Citb Europe Manager Close
131 Soter Construction Foamed asphalt
Foamed asphalt contractor.
Robichaud Contactcanadarobert Goodfellow Fax Delson
132 S&D Service Co. Victoria, TX
Victoria, TX based residential HVAC contractor.
Conditioning Residential Air Heating Texas Victoria Sd Information Specializing Heat Cooling Sndaccom Webmail Services Andmodels
133 G.M.S. Full service
Full service HVAC contractor based in Mifflinburg, PA.
134 Masley, Gregory Network engineer
Network engineer and contractor. CNA, CNE, MCSE.
135 Dynamic Services Melbourne, Australia
Melbourne, Australia HVAC contractor.
Z Here Visiting Upload Optusnet Soonif Homepage Another Owner Cablemembers Optus Internet
136 JC Heat & Tile Sub-floor radient
Sub-floor radient heating contractor.
137 The Contractor Pages A national
A national building trades directory.
Wordpress Hello World Contractor Uncategorized Blog Page Sample Rss Wordpressorg Pages Entries Proudlymr
138 Chill Out Air Conditioning Residential /
Residential / commercial HVAC contractor.
Airconditioning Tenerife Fixit Frankie Browser Heating Refrigeration Supportdoes Cooling Pleasewwwfrankiefixitcom
139 Dans Language Service Translation in
Translation in English/Afrikaans/Dutch/German>,English/Afrikaans, and language editing and proofreading in Afrikaans and English. Freelancer Dan Steyl based in South Africa. Site in English and Afrikaans.
Tripodcom Create Tripod Page Lycos Help Pricing Website Hosting Couldnt Check Blog Requested Lycoscom Y
140 Metro Heating & Cooling Pittsburgh, PA
Pittsburgh, PA residential HVAC contractor.
141 Reynolds, Inc. Utility contractor
Utility contractor specializing in water and wastewater systems.
142 Airstron Ft. Lauderdale
Ft. Lauderdale, FL. full service commercial HVAC contractor.
Hvac Airstron Coming Soon Salesz
143 Skylake Heating and Air Conditioning Sandy, UT
Sandy, UT residential HVAC contractor.
144 Jav-air Heating & Air Conditioning Lakewood, CA
Lakewood, CA residential / commercial HVAC contractor.
145 Elkins Technologies Electrical and
Electrical and communication contractor in Aurora Illinois
146 Elite Air Inc. New Jersey
New Jersey full service residential HVAC contractor.
147 All Seasons Heating and Cooling Green Bay
Green Bay, WI residential HVAC contractor.
Green Contractor Roofing Hvac Contractors Domain Suspended Bayz
148 Bell Air Heating and Air Florissant, MO
Florissant, MO residential/commercial HVAC contractor.
Bellairhvaccom Wwwbellairhvaccom Saley
149 Wallace A/C & Heating Co. Sealy, TX
Sealy, TX residential/commercial HVAC contractor.
Wallace Heating Instantpage Poweredair [[domain]] Godaddycom See Daddygo Want Httpwallacehvaccom
150 Finney Heating & Air Doraville, GA
Doraville, GA residential/commercial HVAC contractor.
Under Constructiony
151 Veterans Service Co., LLC Woodstock, CT.
Woodstock, CT. residential / commercial HVAC contractor.
152 Combi Services Central heating
Central heating contractor serving Southampton, UK.
153 Areas Air Conditioning Palm Harbor
Palm Harbor, FL. residential HVAC contractor.
154 Custom Air New England
New England full service residential HVAC contractor.
Air Custom Request Hvac Has Heating Leader Industry Superior Farms Furnace Ductwork Itself Made Gas Y
155 Heat Exchange Systems, Ltd. Denver, CO.
Denver, CO. based HVAC contractor.
Z Y
156 Air Essentials Vacaville, Ca.
Vacaville, Ca. residential full service HVAC contractor.
157 Contractor Guide National directory
National directory of contractors, suppliers and manufacturers.
Contact Contractormobilelinks Read Flooring Mobile Remodelingcontractorskitchensuggestionsflooringadvice Kitchen Repairs Copyright Home * Guide * Learnguide Improvement
158 YardBids Landscaping bids
Landscaping bids and contractor directory where a job can be posted anonymously.
Psa Rbs Gs Wfc Bac Nee Bbt Usb Ms Kim Jpm Frc Dlr Bcs Nmih Rell Cnce
159 Alcom Services Inc Full service
Full service telecommunications and electrical contractor.
Services Contact Security Fiber Projects Electrical Optical   Inc Installations Alcom Wiring Marketing Data
160 Krupp Uhde Chemical engineering
Chemical engineering contractor and plant construction.
161 A-A Mechanical Full service
Full service residential/commercial HVAC contractor.
Chicago Heating Mechanical Furnace Conditioning Repair Air Seer Certified Company Installation Boiler Carrier Rheem Coleman Great Part Forced Unico Running
162 Georgie Floors Hardwood flooring
Hardwood flooring installation contractor in southern US.
163 C and C Construction Co., Inc. Full service
Full service facility maintenance services contractor.
164 u.s. railways, inc. freight railroad
freight railroad intra-plant switching contractor.
Railways Freight Intra Plant Railroad Switching Inc Ave Milwaukee Chicagoincshome Smallyou Contractor Since
165 UDC Corporation Industrial and
Industrial and commercial general contractor. Anaheim, California, USA.
166 The DFH Company, Inc. Residential -
Residential - Commercial HVAC contractor based in Louisville, KY.
Z Y
167 lockheed martin -syracuse prime contractor
prime contractor for many sonar systems.
168 Hillestad Heating & Air Conditioning Residential/Commercial HVAC
Residential/Commercial HVAC contractor.
169 wazee electric electrical contractor
electrical contractor profile and job contact information.
Motor Repair Field Crane Wazee Electric Sales Wind Motors Generator Predictive Word Electrical Hn Mechanical Products Useful
170 J.T.Hickman Co., Inc. Contractor installer
Contractor installer of Sunrooms, siding, roofs and windows
171 Opus Building Corporation Commercial design
Commercial design build contractor.
Commercial Building Corporation Opus Optimus Contractor General Team Finish Contractors Plans Design Provides Buildingcorporation Single
172 Tenix Group Defence and
Defence and technology systems integrator and contractor.
Tenix Awards Water Sustainability News Publications Privacy Wastewater Australia Use Contact Working Development Gt Environment Terms Finalist Sponsor
173 Airmasters-Services Springfield, IL
Springfield, IL full service commercial HVAC contractor.
174 Simpson Heating and Cooling New Philadelphia
New Philadelphia, OH residential/commercial HVAC contractor.
Heating Air Conditioning Cooling Simpson Commercial Residential Geothermal Services Systems Industry Philadelphia System Ohio New Overhead Saving Heatingtext Aligncenterfont
175 FridgeTek Full service
Full service commercial / industrial HVAC contractor based in UK.
Conditioning Bedfordshire Refrigeration Fridgetek Air Company Maintenance Supplier Installation Uk London Specialist News Studies Andinstallation England Case
176 Nicholas Aire Systems California based
California based residential HVAC contractor.
177 Thermalair Inc. Full service
Full service HVAC and Refrigeration contractor based in Anaheim, CA.
Conditioning Air Construction Industrial Engineering Contractor Diversity Comprising Calibration Aqmdaudits Refrigeration Distributor Full
178 COMMUNITYII Staten Island
Staten Island, NY full service residential HVAC contractor.
179 DPG Plus HVAC and
HVAC and commercial building service contractor operating throughout the United Kingdom.
180 Lee Heating and Air Conditioning Westminster, South
Westminster, South Carolina residential HVAC contractor.
181 L.E.S. Heating & Air Co. Wheeling, IL
Wheeling, IL full service residential /commercial HVAC contractor.
182 Surety Company of the Pacific Provider of
Provider of California contractor license bonds.
Hcc Bonds Insurance Liability Surety Life Company Professional Global Contacts Claims Risk Commercial Contract Credit Taft Hartley Protection Bbb
183 CityITjobs.com IT contractor
IT contractor marketplace, where employers and freelancers contract with each other using an auction format.
Z Request Y
184 nabors industries, inc. onshore and
onshore and offshore drilling, well-servicing, and workover contractor.
Drilling Services Technology Nabors Investor Learn Industries Rigs Software Land Coiled Specialty Fluids Stimulation Wireline Annual Environment Operations
185 Central Mechanical Residential and
Residential and commercial full service HVAC contractor.
Air Conditioning Heating Houston Commercial Request Maintenance Residential Repair Ac Contact Central Mechanical Partners
186 Herman Goldner Co., Inc. Full service
Full service HVAC and plumbing contractor serving PA, NJ, DE.
Herman Goldner Mechanical Services Inc Co Project Company Philadelphia Construction Building Systems What’s Plumbing Pa Community Automation Union
187 Herman Goldner Co., Inc. Full service
Full service HVAC and plumbing contractor serving PA, NJ, DE.
188 Victor Distributing Company Caters to
Caters to the licensed air conditioning and mechanical contractor.
189 A Custom Heating and Air Conditioning, Inc Full service
Full service residential HVAC contractor.
190 FurnaceClean Ontario, Canada
Ontario, Canada residential heating service and sales contractor.
191 ACentral Houston, TX
Houston, TX full service residential/commercial HVAC contractor.
192 SECCO, Inc. Camp Hill
Camp Hill, PA residential / commercial mechanical services contractor.
Electrical Commercial Services Camp Hill Lighting Solar Pa Construction Hvacr Portfolio Hvac Refrigeration Contact Equipment Rhelmod_auth_passthrough Quicktricity
193 H.V.A.C. of Wisconsin, Inc. Racine, WI
Racine, WI full service residential / commercial HVAC contractor.
194 Stringliner Company Manufacturer of
Manufacturer of line reels for the experienced contractor or the do-it-yourself handy man.
Holders Line Reels Tape Tools Extension Stringliner Construction Tool Cord Barricade Company Nylon Dispensers Where Call
195 C.L. Linfoot Co. Grand Forks
Grand Forks, ND based residential/commercial HVAC contractor.
Linfoot Cl Click Co Here Grand Video News Hvac Forks Roofing Play Above Call Schedule Custom Roof
196 BTB Australia Australian underground
Australian underground utility contractor specializing in directional drilling.
Drilling Directional Civil Works Australia Web Ltd Btb Ideasptyprojects
197 Rayer Design Limited Exhibiti designer
Exhibiti designer and contractor. Hong Kong.
198 Comfy Air Yorkshire, UK
Yorkshire, UK full service residential/commercial HVAC contractor.
199 1-800-Any-Tyme AC service
AC service contractor serving Los Angeles, Riverside, San Bernardino, and San Diego, CA.
Permanently The Port Server Apachez
200 Gelidus Limited UK full
UK full service commercial and residential HVAC contractor.
Conditioning Air Berkshire Gt Company Reading Maintenance Contact Repair Gelidus Call Design Installation Limited Environmental Lease Compliance

2. Shopping and Freelancer contractor Trade

1 A Womans Guide to Hiring a Contractor A womans
A womans guide to hiring a contractor, company or any service provider.
Z Y
2 Build Home Guide to
Guide to being the general contractor.
House Technology Concrete Gallery Share Residential Build Design Home _建 Better Us Jkying@gmailcom Locationtoppxleftpxz Okinawa Buildingindexheightpxwidthpxbackgroundtransparentbordernone *
3 Homeimprovementinfo.com Sells a
Sells a guide that provides advice on how to choose a contractor.
Improvement Home Leading Homeimprovementinfocom Ityourself Remodel Homeimprovement Ideas Materials Bathroom Remodeling Jointhousands Netcontractor
4 Harmony Grove, Inc. Providing bamboo
Providing bamboo floors. Installation available by licensed contractor.
Ñèñòåìû äèïëîì îõðàíû íà Êóïèòü Request çàùèòû äëÿ Harmonygroveflooringcom îáðàçîâàíèè î âèäåîíàáëþäåíèÿ äîñòóïà Ïîæàðíî
5 Golfscape Designs About synthetic
About synthetic greens for putting, the contractor, and photo gallery.
Navigationshilfet Y
6 The Western New York Floor Co., Inc. Consultant and
Consultant and contractor for athletic flooring. Provides news, FAQ, and map of territory.
Blog Portfolio Floors Full Styles Width Layout Floor Example York Project Western Company Slider University Alternate Gallery Robbins
7 Mildman Featuring concrete
Featuring concrete contractor tools. [Best Viewed on IE, doesnt work in all browsers.]
Tripod Create Requested Lycoscom Please Hosting Check Login Website Page Couldnttripodcom Signup Shopping
8 PondScapeDesigns.com Authorized contractor
Authorized contractor and retailer of Aquascape Designs garden pond supplies.
Z Y
9 The Western New York Floor Co., Inc. Consultant and
Consultant and contractor for athletic flooring. Provides news, FAQ, and map of territory.
Z Y
10 R.E. Williams Contractor Inc. Sells whole
Sells whole house exhaust fans. Discusses sizing, provides testimonials and installation instructions.
House Whole Fans Fan How Requirements Roof Cool Attic Size Policy Blog Properly Found Quietcool Privacy Port
11 Steve Austin Painting Learn faux
Learn faux finishing from a California artisan, contractor, and instructor with over 20 years of experience.
Providerfor Contactdisplayederror Page Please Cannot
12 Westfire Manufacturing, Inc. Manufacturer of
Manufacturer of fireplace mantels, mantel surrounds, stairs and stair parts for the homebuilder and contractor.
Balusters Newel Handrail Stair Posts Iron Series Box Collection Round Newels Colonial Post Steel Hampton Flat
13 Clever Kid Designs Offering aprons
Offering aprons and bibs with pockets in many styles including baker, crafter, gardener and contractor.
Clever Kid Aprons Childrens Play Child Apron Art Kids Themed School Kitchen Designs Schedule Preschool Artistic Preschoolers Teacher
14 Infra-Red Products Sells garage
Sells garage, portable, outdoor, and construction heaters, as well as furnaces and fireplaces. Provides contractor, FAQ, and news pages.
Heaters Infrared Shop Patio Heat Outdoor How Radiant Heater Garage Construction Review Wall Superior Tube Habanero
15 Miller Bros. Paint & Decorating Stores - Online Offers materials
Offers materials for both the do-it-yourselfer and the full service painting contractor.
Plesk Parallels Default Containers Panel Control Page Using Reserved Copy Discovervirtuozzo Parallelsvirtuozzo Server
16 Vehicle Accessories Offers aftermarket
Offers aftermarket products including nerf bars, truck caps and Truxedo tonneau covers. Features a contractor section.
Truck Liner Accessories Liners Vehicle Industries Covers Cover Suspension Directions Racks Products Ladder Tailgate Caps Monday Friday Draw Tite Fold Sno Way
17 Contractor Books Reference books
Reference books, plus videos, software and study guides for the construction industry.
Books Codes Construction Electrical Building Cost Tools Contractor Code How Means Meters Estimator Bookscom Plumbing
18 Lighting Valley Sells recessed
Sells recessed, track, outdoor, and landscape lighting. Provides contractor and government sections.
19 Contractorbargains.com Specialize in
Specialize in merchandise for the contractor or do-it-yourselfer including tools, home and garden items, heaters, fans and construction safety items.
Heaters Safety Event Tools Parts Electrical Propane Batteries Protection Misc Industrial Plumbing Contact Accessories Patio Concession Lights Evaporative Hearing
20 Deck USA Deck plans
Deck plans and designs. CD-rom, contractor referral, deck software.
Deck Plans Decks Designs Shed Design Software Patio Rom Plan Cd Custom Information Usa Free Deckbrackets Square
21 Accessibility Lifts Wheelchair lift
Wheelchair lift accessibility contractor in South Florida. Specializes in commercial and residential lifts.
Free Page Construction Accessibilityliftscom Luxury Policy Tickets Credit Zone Smart Trademark Phones Insurance Review Rates High Migraine
22 PF Pros Pond and
Pond and fountain equipment and supplies. Information and diagrams for the contractor, architect, or experienced do-it yourselfer to help design, build, maintain, and troubleshoot a pond or fountain.
Fountain Supply Pond Water Garden Fountains Indoor Outdoor Supplies Equipment Sand Filter Pros Waterfall Pump
23 Lineberry Tennis Tennis court
Tennis court contractor that offers hard and soft court resurfacing and construction. Fencing, lighting installation, and tennis accessories are also offered.
Lineberry Click Tennis Profiles Project Installations Surface Sign Services Contact Here Faqs Surfaces Court Store

3. Freelancer contractor Recreation

1 LAR, Ltd. (UK) Asbestos removal
Asbestos removal contractor, located in Stockport.
Policy Manchester Office Contact Town Park Recently Accreditations Crossley Welcome Company Email Personnel Fax Services Halllibrary Healthand
2 Greenspoon Bros. Limited Asbestos abatement
Asbestos abatement and demolition contractor in Ontario, Canada.
Create Tripod Hostinglycoscom Website Requested Lycos Page Tripodcom Signuplogin Shopping Check
3 Watkins Contracting, Inc. San Diego
San Diego based construction management and environmental clean-up contractor.
Contracting Watkins Inc Copyrightincwatkinsrightsreserved Inc‚ÉÅ Ö‚·Ã¢â‚¬Å¡éî•ñ Inc‚»Ã¢â‚¬Å¡Ì‘¼Ã… ÖËœaî•ñ
4 Bad Company Rodeo Contractor for
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Here Bull Click Bad Contact Learn News Genetics Texas Little Expect Bulls Mixed Finals Riding
5 Bad Company Rodeo Contractor for
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Here Bull Click Contact Bad Unexpected Learn Prca News Schedule Hammer Finals Way Deer Nationalfinals
6 Toy Trucker & Contractor Offers monthly
Offers monthly publication for collectors. Includes sales, shows, and subscription information.
7 Bad Company Rodeo Includes contractor
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Here Bull Click Bad Contact Unexpected National News Gallery Finals Hammer Inc Schedule Bucking Awesome
8 Bad Company Rodeo Includes contractor
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Here Bull Click Contact Bad Inc Wrangler Unexpected Texas Stock Bulls West Wild Tour
9 A Q Environmental Full service
Full service environmental contractor in Los Angeles, performing asbestos removal and other services.
Mold Cleanup Rental Damage Removal Water Asbestos Air Restoration Equipment Abatement Dehumidifier Lead Carpet Testing Control Hepa Referencess
10 Flying U Rodeo Co. Californias stock
Californias stock contractor. Information on professional rodeo production and the original 'Born to Buck' program.
Bucking Horses Bulls Rodeos Flying Horses_rodeos Rodeo Bulls_bucking Performance Sale Nfrpbr Award Striving Winning Heifers
11 California Skateparks General contractor
General contractor for concrete skateparks. Includes references, company profile, resume, and contact information.
Wally Hollyday Skateparks Skate Park Atlanta Open Designbuild Laurel Click Here Wally@skatedesigncom Tour Approach Phase Settles Designed
12 Cooper Radiology Contracting, Inc Radiologist offering
Radiologist offering USA nationwide services as an independent contractor to help healthcare facilities with short term staffing shortages in diagnostic radiology.
Navigationshilfe Ty
13 A-1 Miniature Golf Design and Construction Contractor profile
Contractor profile and information on services and projects building miniature golf courses.
Z Y
14 Contractor City Construction Jokes Construction and
Construction and building trades-related jokes and humor.
Z Y
15 The New England Laborers Health and Safety Fund A joint
A joint labor-management organization that works with the union and the contractor for the benefit of union members and signatory contractors through a more safety conscious and productive workforce.
Winter Laborers Smoking Type Health Nelhsf Storms England Year’s Homepage Chantix Storm Cessation Set Resolution Keep Loss Heavy Gloves
16 Environmental Health Resources, Inc. Health and
Health and safety consulting and programs, indoor air quality, industrial hygiene, asbestos management, lead, environmental health, OSHA, contractor supervisor training, asbestos worker training. (MI)
Ehr Ehrinccom Advancedmd Falcon Behr Target Section Legal Here Systems Bestterms Learn Browse

4. Computer & Freelancer contractor Games Websites

1 ACT Contractors Forms Construction form
Construction form software, California contractor forms, other states, general contractor forms, roofing, painting, other trades. Contractor legal forms and contractor business forms.
Forms Contractor Form Contractors Construction Software Other Help Print Roofing General Laws State Contractorforms Need
2 Contractor Software Corporation Accounting and
Accounting and job costing software for the construction industry, including Contractor V. Software demo, dealer opportunities, and contacts.
Software Accounting Contractor Construction General Job Project Electrical Commercial Advisor Payroll Repair Specialty Government Insurance Products Technology
3 ConTracker E Z - Contractor Estimating Software General contractor
General contractor business estimating software for roofing, siding and all construction uses.
Injury Accident Personal Laura Soltis Rss Cases Dog Injuries Auto Bites Claims Bit Brain Tampa Johnbalescom
4 PHP Freelancer PHP jobs
PHP jobs and contract work auction.
Click Here Proceedz
5 Y Studio Freelancer offering
Freelancer offering web site and graphic design services in English and Japanese.
Design Designer Japanese Web Graphic Banner Commercial Internet Animation Marketing Commerce Freelance Html Identity Services Pre
6 Kardin, Andreas Software developer
Software developer, freelancer page. Shareware and freeware programs, experience description, programming hints collection.
Error Programming Zone Hints Techzone Web Galerien Jahrgegliedert Umzge Occured The List Liste Platzbitte
7 Maverick Communications, Inc. Telecommunications contractor
Telecommunications contractor servicing Texas and southwest Louisiana.
Maverick Company Systems Partners Contact Inc Cabling Quote Structured Alarms Telephone Employment Services Burglar Security Profile
8 The American Contractor Offering a
Offering a construction accounting and management software package for Windows.
Management Maxwell Software Systems Project Equipment Gt Construction Success System Privacy Financial Demo Modules Take
9 Jeff Tapper Independent contractor
Independent contractor and certified instructor covers ColdFusion, Flash, and Flex.
Navigationshilfey
10 Peabody NC Programming Corporation An independent
An independent SurfCAM contractor, offering to write programs for all CNC hardware.
Z Y
11 Richard A. DeVenezia I am
I am an independent contractor that can help you turn raw data into information that is delivered to your internal or external customers.
Nesug Sesug Sugi Using Sasr Windows Tournament Sas Richard Contact Generator Storing Perl Round Geometry Topic Sasafr Strip Javaobj
12 Brown, Martin G. A log
A log of issues faced by a .Net contractor, and the resolutions he used. There is a mixture of C# and VB.Net. It also contains items seen by the author as interesting to .Net developers.
Plesk Mgblog Code Developers Dump London Group Net Hosting Vbnet Parallels Source Regexeditor Domain Learn Converting Itdownloads Sourcesafe Microsoft
13 Clear Solutions Resellers of
Resellers of Intuit Master Builder and Quickbooks Contractor Edition offer consulting for the construction industry.
Z Y
14 SDS Command Post 3000 Offers business
Offers business management software for the contractor and service industry. Includes screenshots and demo request.
Software Dispatch Contracting Command Post Systems System Management Business Dispatching Ultimate Computer Requirements Metal Accounts Productive Parts Reserved
15 Embedded Technologies Software/hardware development
Software/hardware development contractor. We specialize in Windows programming in Visual Basic. Based in Owasso, Oklahoma.
Software Visual Basic Vbsizer Activex Windows Embedded Technologies Computer Using Automatic Control Form Resizing Programming Homeof
16 CSCI Software Systems Contractor billing
Contractor billing automatically on AIA documents G701, G702, G703, G701Cma, G702Cma. For Windows 2000, NT, 98, 95 on CD ROM.
Software Billing Contractor Document Construction Aia Documents Gcma Click Invoice Csci Here Windows Cbsnet Order
17 Testing Circle Ltd. Contractor placement
Contractor placement business specializing in software testing.
Jobs Testing Courses Mobile Software Circle Academy Partners Consultancy Recruitment Events Network Circles Managers
18 Builders Software Residential construction
Residential construction software for contractor or owner builder.
Software Construction Contractor Weather Print Business Adobe Severe Acrobat Products Recovery Restoration Trade Homeowner Suite Planners Schedule
19 Websites4Contractors Offers design
Offers design and marketing services for contractors and contractor services.
Contractors Contractor Construction Web General Sites Websites Directory Remodeling Resources Services Concrete Abatement Website Siding
20 Contractor Software Construction forms
Construction forms and agreements on fill-in software.
Answers General Order Contracts Forms Samples Notice Expertly Construction Testimonials Lien Articles Tile Agreement Mechanics Conditional Painting
21 PrioSoft Priority One
Priority One Plus business software for the construction, contractor, handyman, and automobile dealer industries. Includes contact management, accounting, and other features specific for each industry.
Software Construction Estimating Office Priosoft Cost Contractors Contractor’s Project Partners Management Support Free Scheduling Contact Mission Priosoft’s Virtual Whether
22 Saunders Contracting Services Full service
Full service communications installer to include voice, data, and fiber optic systems. Also a state licensed electrical contractor.
Electrical Contractor Services Industrial Telecommunicationshomeserviceshistorycontact Virgina Electric Contracting Hampton Historyincelectrical Commercial Saunders Va
23 PrioSoft Makers of
Makers of Priority One Plus business software for the construction, contractor, handyman, and automobile dealer industries. Includes contact management, accounting, and other features specific for each industry.
Construction Software Estimating Office Priosoft Cost Contractors Contractor’s Project Partners Support Management Create Scheduling Cloud Estimates Trial Dc Commercial
24 Team Management Systems HVAC, Plumbing
HVAC, Plumbing, Electrical software designed for the contractor. Product information, meet the team, credentials, training and support.
Management Team Systems Acomarc Windows Acowin Acotruck Software Learn Acorate Project Flat Rate Mobile Work Pro Ldquobest Unix
25 American Contractor Construction estimating
Construction estimating software for bidding and cost control. Training included with every system. Flexible job cost tracking, accounting and service dispatch packages.
Estate Real Amer Leading Amerconcom Net Con Advice Brokers Insuranceagents Propertymanagement Mortgages Join
26 Contractor V Powerful accounting
Powerful accounting and job costing software with features allowing contractors to control cost and eliminate waste specifically designed for the Construction industry and flexible for all types of contractors.
Company Recetas Financial Corp Stock Investors Soft Reports Investor Mobilya Privacy Investment Listings Finance Sponsored Plus™ Demokonto Annual Related
27 Contractor Anywhere, Inc. Enterprise construction
Enterprise construction management and service management dispatch software for general, service, specialty, and residential contractors.
Legacy Sage Nexuswebcd Sage Z
28 Jacquinot Consulting, Inc. Smart Card
Smart Card consulting in Atlanta, GA, USA: contractor for software development and project management. Specialized in security chips, smart cards, security tokens and dongles via PC/SC, ISO 7816 standards.
Smart Card Development Software Consulting Contact Services Customization Cards Evaluation Jacquinot Atlanta Security Technical System Biometrics Multos Consultancy
29 Profitool Inc. Comprehensive construction
Comprehensive construction accounting and job cost software for the large contractor. Clients range from heavy/highway to large specialty and general contractors. Includes dispatching, human resources, general ledger, equipment, billing, report writer, GUI interface.
Contact Request News Map Profitool Login Constructionsoftware Clientaccounting
1 Official Freelancer Site Microsoft Games
Microsoft Games Studios presents Freelancer
Microsoft Windows Security Phone Support Essentials Bing Center English Store Sites Download Office United Gaming Investor
2 Game Stuff - Freelancer FreeLancer related
FreeLancer related news and screenshots, discussion forum and polls.
Business Yahoo Email Plans Marketing Small Ecommerce App Advisor Local Hosting Help Gallery Network Screen Sports Install Beauty
3 Aktion Enterprises Painting Contractor
Painting Contractor with a knack for painting miniatures and building terrain. Website contains photo galleries of work and contact information.
Navigationshilfe Ty
4 BLACK Freelancer Clan Home The home
The home of the BLACK Freelancer Clan.
Re [phcn] Deepdream Smf Snippetsemail New Reverse [bash] Engi Fraggle Bilder Posts Copy
5 Lancers Reactor Information on
Information on Starlancer and Freelancer. Walkthrough and forum.
Freelancer News Mod Rate Server Space Star Citizen Starport Update Rating Downloads Year Dedicated Releases Studio
6 Lancers Reactor Information on
Information on Starlancer and Freelancer. Walkthrough and forum.
Freelancer News Mod Rate Space Server Citizen Star Update Starport Downloads Year Rating Mostly Harmless
7 FiringSquad Review by
Review by Tom Chick, 83%. 'Freelancer could have been so much better with a little more work. But in the end, it serves its purpose.' With screenshots and user reviews.
Z Y
8 Digital Anvil Developer of
Developer of Freelancer, Starlancer, Loose Cannon, and Conquest - Flash required.
Xbox Windows Games Surface Contact Microsoft Phone Live Store Office Entertainment Soon Coming Accessories Support
9 EOA Players Consortium Offers modifications
Offers modifications and editing utilities, including Software Development Kit, Freelancer Explorer, and Ini Analyzer.
Dreamhost Coming Discussion Soon Wiki Panel Forum Eoaseriouszonecom Domain Website Uploaded Ownerweb Also
10 Action Trip Review, 82%.
Review, 82%. 'Play it patiently, explore, fight and enjoy... It just might do the trick before the heavy hitters like Starlancer and Freelancer arrive.'
Cheats World Frontier Lego Jurassic Beyond Far Days Pc Witcher Ago Cry Wild Review Hunt Best Pspdcom
11 Harry Macks Video Game Music Contractor available
Contractor available for work. Download samples of Harry Macks Video Games Music
Sound Game Music Audio Apache Casual Rpg Indie Ipad Mack Server Effects Contractharry
12 Microsoft Games: News The official
The official news page on the Lancer series and its forthcoming game, Freelancer.
Games Xbox Video Best Store Windows Conduct Console Movedthis States Privacy Franchises Code Official Warning
13 MC Gamers Plays Americas
Plays Americas Army, Battlefiield, Call of Duty, Freelancer, Joint Operations, Medal of Honor, Wolfenstein: Enemy Territory, and MMORPGs. News, discussion forums, maps, screen shots, enlistment form, and downloads.
[mc] Sgt Happy Birthday Gamers News Behavior Psycho Krs Login Luckoduck Simpleportal Register Killa$ Welcome Medal

5. Sports Websites concerning Freelancer contractor

1 Bad Company Rodeo Contractor for
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Bull Contact Bad Here Schedule West Gallery Unexpected Inc Genetics Stock Expect Little Tour George
2 Bad Company Rodeo Contractor for
Contractor for Texas area. Includes performances, dates, and results.
Rodeo Company Contact Bull Bad Here Genetics Bulls Unexpected Stock Mixed Inc Wild Production Expect George
3 Bad Company Rodeo Includes contractor
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Contact Bad Bull Here Stock Schedule West Little Expect Mixed News Tour Prca Contractor National
4 Bad Company Rodeo Includes contractor
Includes contractor information and rodeo dates for most of Texas.
Rodeo Company Bad Bull Contact Here Tour Stock Expect Mixed Little Wild Inc Production News Bulls Altizer
5 Flying U Rodeo Co. Californias stock
Californias stock contractor. Information on professional rodeo production and the original 'Born to Buck' program.
Rodeo Prca Fair Ndash County Bull Sun Bulls Sat Riding Charro Flying Fiesta Thur Only
6 California Skateparks General contractor
General contractor for concrete skateparks. Includes references, company profile, resume, and contact information.
Rejected Requesty
7 A-1 Miniature Golf Design and Construction Contractor profile
Contractor profile and information on services and projects building miniature golf courses.
Navigationshilfey

6. Society, Arts and Freelancer contractor Crafts

1 Independent Contractor Agreement Sells a
Sells a lawyer-approved standardized contract to use as a guideline when customizing a contract for an independent contractor or freelancer.
Independent Contractor Agreement Freelance Sample Contract Contact They Policy Word However Professional Freelancer Privacy Documents Payment
2 Working as an Independent Contractor Article covering
Article covering the pros and cons of becoming an independent contractor and how to get started.
Independent Contractor Careers Contractors Jobs Resignation Policy Tech Letter Job +t+ Privacy Learn Consulting Aboutcom Tax
3 Shout 99 UK freelancer
UK freelancer network.
Z Y
4 H4x3d.com Web designer
Web designer and freelancer Julian Klewes thoughts about politics as well as everyday situations.
Cloudflare Error Connection Working Youre Themost Host Owner Timed Browser Visitorcloudflares Frankfurt Website Please
5 Discrimination Blog by Daniel Musings of
Musings of a gay low-profile IT freelancer in San Francisco who plays piano, flies planes, and sues his psycho ex-boss for discrimination.
6 Ankida Independent contractor
Independent contractor positions with training through this company. Details of packages, experience required, and what to expect.
Z Y
7 realty signatures nationwide services.
nationwide services. offers online service ordering and independent contractor information.
Soon Future Cool Something Coming Check Owner Visitoryoure Launch Please Z
8 coastal closings serves the
serves the state of florida. offers services, independent contractor sign up and invoicing, and contacts.
Mobile Florida Notary Services Signing Contact Notaries Invoice Company County Miami Calendar Rescission Closings Throughout
9 sea hawk enterprises, inc. construction management
construction management and consulting firm with over 28 years experience as california, arizona and nevada licensed contractor.
年月 年月日 日記 Wordpress Ocnの格安simで節約 観光スポット Just 上諏訪温泉 格安simに変えてから　その後１ インフルエンザの流行 メロンパン 家族旅行│おすすめ情報 洗濯物の中に蜂 Rss Wordpressorg
10 christopher t. restak hanover attorney
hanover attorney, with experience as a construction lawyer, architect, general building contractor and attorney.
Learn Construction Attorney Providing Practice Video Profile Mrsfields Practice Realdevelopment Related Issues Estate Fine Clients
11 john sevier certified arborist
certified arborist, tree maintenance contractor, and court qualified tree safety expert.
Tree Expert Accident Witness Contact Sevier Power Line California Public Cases Services Johnny Crape Myrtles Latest Depending
12 john sevier a certified
a certified arborist, tree maintenance contractor, and court qualified tree safety expert.
Tree Expert Accident Sevier Witness Johnny Braunfels Insurance Pruning Management Contact Trees Removal New Wrongful Consultant Arborist
13 clinton j. ford p.a. florida based
florida based general contractor providing consultation, litigation support and expert witness testimony for construction claims, delays and damage cases.
Construction Building Environmental Mold Consulting Expert Information Estimating Advanced Consultants Witness Glossary Resources Gallery Florida Each Defensive Resources We
14 competitive solutions group expert witness
expert witness for plant damage, contractor performance and related project deficiencies in the cable television and local exchange carrier industries. located in illinois.
Navigationshilfe Ty
15 the pd group unlimited, inc. serves indian
serves indian river, broward, palm beach, st. lucie, martin counties. offers services, fees, contacts, online ordering, and client and contractor registration.
Navigationshilfe Ty
16 Boeing T-45 Training System Offers background
Offers background information, simulators, training integration, instructional programs, contractor logistic support, news releases, photos, and multimedia in .avi and .mov formats.
Boeing Space Learn Defense Global System Commercial Engagement Merchandise Launch United Multimedia Phantom Military News Series Frequently Cybersecurity
17 glass mediations douglas a.
douglas a. glass,esq. civil mediations and arbitrations related to real estate, construction defects, contractor disputes, and personal injuries. based in san diego, california.
Mediations Glass Diego Doug Calendar Mediator Douglas California Learn San Practice Areas Mediators Claims Page
18 Home Envy: Mag Ruffman Archive of
Archive of DIY projects and guides. Mag Ruffman worked as a licensed contractor before hosting televisions A Repair to Remember and Anything I Can Do. Information geared to women doing home repairs.
Homes $ Springs Colorado Sale Estate Real Stone Fort Carson Views Stucco Custom Flying Creek Popular New Guide Convenient
1 Soar, Duncan Freelancer based
Freelancer based in London, UK. Portrait and documentary photography.
Photography Corporate Work London Other Commercial Event Book Portraits Conferences South Exhibitions Urban Jackets Groups Duncan Office
2 Mason, Rich A freelancer
A freelancer based in Virginia. On site: a series of projects in color and monochrome.
Dosarrest Security Internet Restricted Client Ddosprotection Pleaseprotectionhost
3 donahue design custom murals
custom murals and faux finishes and workshops by anna donahue, professional artist and licensed contractor.
Domain Sale Now Premium Artmuralcom Request Price Maximize Domainmarketcom Buy Ready@ Now_ Easily
4 dannenbeck studios sculptor and
sculptor and designer/contractor team up to design, fabricate and install both public and private site-specific sculptural tile artworks and large scale ceramic sculptures.
5 NY Rock - Theyre Not So Angst-ridden Once You Get to Know Them NY Rock
NY Rock freelancer Gabriella talks with Radiohead about their new music.
Thom Colin Radiohead Nyrock Rock Send Miss Ny Boys Gabriella Music Yorke Once Joan Beastie Theo Angst Ridden Page Napolitano Kid Lauper
6 the media desk journalist, freelancer
journalist, freelancer, humorist, and professional observer levite covers sports, religion, politics, with essays and humor thrown in for good measure.
7 Home Envy: Mag Ruffman Archive of
Archive of DIY projects and guides. Mag Ruffman worked as a licensed contractor before hosting televisions A Repair to Remember and Anything I Can Do. Information geared to women doing home repairs.
$ Homes Colorado Springs Sale Real Ranch Estate Peak Horse Pikes Communities Page Property |
8 Winget, Justin Resume and
Resume and portfolio of undergraduate designer and freelancer Justin Winget.
Z Inspire Create Justin Mug Flickr Jinget Linked Smug Fillcreative Dub Aboutme

Freelancer contractor Dictionary

contractile organ / contractor: a bodily organ that contracts
contractor: someone (a person or firm) who contracts to build things
contractor: (law) a party to a contract
contractor declarer: the bridge player in contract bridge who wins the bidding and can declare which suit is to be trumps
defense contractor: a contractor concerned with the development and manufacture of systems of defense
freelancer / freelance / free-lance / free lance / independent / self-employed p: a writer or artist who sells services to different employers without a long-term contract with any of them
SiteBook.org Reviews for Freelancer contractor. The business hours may vary on holidays like Memorial Day, Independence Day and Labor Day, Columbus Day, Veterans Day and Thanksgiving Day - Statistics: 3 SiteBook Points for "Freelancer contractor" (visitors of this topic page). Freelancer contractor › Reviews & Experience Experience and Review Freelancer contractor Opening Times and Reports. Date:

Our Recommendations:




9 results for Freelancer contractor: